Clone BO27136 Report

Search the DGRC for BO27136

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptCG12913-RA
Protein status:BO27136.pep: Imported from assembly
Sequenced Size:1654

Clone Sequence Records

BO27136.complete Sequence

1654 bp assembled on 2010-09-17

GenBank Submission: KX797264

> BO27136.complete
GAAGTTATCAGTCGACATGCATAACTCCCTGGTGACCAAGTTGCTGCTGC
GGCTTTTGCTGCTCTTCGCCTTGTTGACCGGCGCCTCCATTGTGGTGCTC
ACAAAGTGCGGATTCGATGAACTGACGACGAGGGAAACTCAAGCCAATAA
TCCGAGTGAATCCAGCGGATTCAGTTACACCTTAAGCGAACGAGAGGCGG
AAATTGAGCGGCTGAAACAGGAAGTCCTGGCTCTCCGCACTCAAATCCTC
TTTCTACAGAATAATCGCAGCACTGCCAAGCCATCAAATGGCAGTCTTCA
ATTGCAAGAAACCACCGCGGGGCCACCAACTGCACCACTGGGTCACCATT
ACGACTGCAGCAGCTATATTCGCAAGCAGGTGGGCGCCGCAGAAATTCTG
CATGGACTGCCGCTGAACAACGAGTACGAGCTGATACCCTACAATCACTT
CACCTTCACGCGAGTATATCCCATCGACTTGGGCCTGGGAAAGCGCGTGG
TGGAGAAGCCCATCGGTTATCGACGACGTGACCTCATCGAGGCGGTAAAC
AAGGCGCTGGAGAGCCTGAACAGGAATCACTCAGCGAGAATACGAGCCAA
GGGAGCTGGTTCTGCAGCGGCTTACGCCTCGGATGTGATCAAATACACCC
TGGATGACTTTATCGAGGGCATATACCGCAACGAACCCACCACAGGCACC
CAGTACGAGCTGTACTTCCAGAGTGTCAAGCACCAGGCGAGTCCAGTGCG
GAGAGCCCTGGTCATGCGACCATTTGCTCCTCTGCAAACGGTGCAGCTAT
CGGAGCTATCTTCCAGTGTGGATAATAGTGGTGCCCCTCCAAGTCATAGT
CCGCCCATAATCCACGTGATACTACCGCTGGCTGGACGTCTGCACAGCTT
TCGCGGCTTCCTGCAGATGTTCGCCAAGCTAGAGGATCGTCGCCTGGAGC
TTATTGTGGTGTACTTTGGAACCAGTGGATTGGAGCAAGCTAGGAGCCTG
GCTGGACGATCCCAAAGGACTCAGTTTTTGGCACTCAATGAGACTTTCAG
TAGGGCCAAAGCTTTAAGACTGGGAGCGGAGCACATTCAACCCGCTGAGG
AGGACGTGCTGCTCTTCATGTGCGACGTGGACATTATGTTCACGACCAAG
TTCCTGGAGCGTTGTCGCTGGAATGCAGCGCCTGGAAAGAAGGTCTACTA
CCCCGTCGTATTTAGCCTGTACAATCCGCATGTGGTGTACTCACTGCAGG
GCAAGCCCTTGCCCAGCGAAGAGGAGCAACTGGTGATATCGAGGGACACC
GGTTTCTGGCGGGACTTTGGCTACGGAATGACGTGCCAGTACCGCTCGAA
CTTCCTAAAGGTGCGCGGTTTCGACGAGGAGGAGATTGTCGGTTGGGGCG
GCGAGGATGTGATGCTATACCGAAAGTATGTTCGATCAAAAATCAAGATA
ATCAGGGCCACCGACCCGGGAATCTTTCACCGCTGGCACACCAAGATCTG
TTCCAGTTCCCTGACAGCCGATCAGTATCGGGCCTGCATTCGATCGAGGG
CCTTGAATGAGGCCTCGCACGCCCAACTGGGATTCCTGGCTTTCCGGGAT
GATATAGCCGCGGCTAATGCGGCAAAGATGACATCGGCAAGCTTTCTAGA
CCAT

BO27136.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG12913-RB 1623 CG12913-PB 1..1620 17..1636 8100 100 Plus
CG12913-RA 1623 CG12913-PA 1..1620 17..1636 8100 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG12913-RB 2523 CG12913-RB 250..1869 17..1636 8100 100 Plus
CG12913-RA 2002 CG12913-RA 250..1869 17..1636 8100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10252987..10254025 17..1055 5195 100 Plus
2R 25286936 2R 10254335..10254639 1191..1495 1525 100 Plus
2R 25286936 2R 10254699..10254841 1494..1636 715 100 Plus
2R 25286936 2R 10254139..10254278 1055..1194 700 100 Plus
Blast to na_te.dros performed 2014-11-28 05:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3983..4015 135..167 120 84.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6880..6940 77..17 116 65.6 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 667..716 91..42 114 74.5 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 8549..8598 91..42 114 74.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2610..2646 76..40 113 78.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6824..6860 76..40 113 78.4 Minus

BO27136.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-20 11:04:51 Download gff for BO27136.complete
Subject Subject Range Query Range Percent Splice Strand
CG12913-RA 214..1833 17..1638 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:28:05 Download gff for BO27136.complete
Subject Subject Range Query Range Percent Splice Strand
CG12913-RA 250..1869 17..1638 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:18:32 Download gff for BO27136.complete
Subject Subject Range Query Range Percent Splice Strand
CG12913-RA 250..1869 17..1638 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:18:32 Download gff for BO27136.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10254701..10254841 1496..1638 98   Plus
2R 10254337..10254639 1193..1495 100 -> Plus
2R 10254140..10254276 1056..1192 100 -> Plus
2R 10252987..10254025 17..1055 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:28:05 Download gff for BO27136.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6142206..6142346 1496..1638 98   Plus
arm_2R 6141842..6142144 1193..1495 100 -> Plus
arm_2R 6141645..6141781 1056..1192 100 -> Plus
arm_2R 6140492..6141530 17..1055 100 -> Plus

BO27136.pep Sequence

Translation from 16 to 1654

> BO27136.pep
MHNSLVTKLLLRLLLLFALLTGASIVVLTKCGFDELTTRETQANNPSESS
GFSYTLSEREAEIERLKQEVLALRTQILFLQNNRSTAKPSNGSLQLQETT
AGPPTAPLGHHYDCSSYIRKQVGAAEILHGLPLNNEYELIPYNHFTFTRV
YPIDLGLGKRVVEKPIGYRRRDLIEAVNKALESLNRNHSARIRAKGAGSA
AAYASDVIKYTLDDFIEGIYRNEPTTGTQYELYFQSVKHQASPVRRALVM
RPFAPLQTVQLSELSSSVDNSGAPPSHSPPIIHVILPLAGRLHSFRGFLQ
MFAKLEDRRLELIVVYFGTSGLEQARSLAGRSQRTQFLALNETFSRAKAL
RLGAEHIQPAEEDVLLFMCDVDIMFTTKFLERCRWNAAPGKKVYYPVVFS
LYNPHVVYSLQGKPLPSEEEQLVISRDTGFWRDFGYGMTCQYRSNFLKVR
GFDEEEIVGWGGEDVMLYRKYVRSKIKIIRATDPGIFHRWHTKICSSSLT
ADQYRACIRSRALNEASHAQLGFLAFRDDIAAANAAKMTSASFLDH

BO27136.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG12913-PB 540 CG12913-PB 1..540 1..540 2782 100 Plus
CG12913-PA 540 CG12913-PA 1..540 1..540 2782 100 Plus
CG9220-PD 832 CG9220-PD 506..792 261..512 297 30.5 Plus
CG9220-PC 832 CG9220-PC 506..792 261..512 297 30.5 Plus