Clone BO27138 Report

Search the DGRC for BO27138

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG5946-RB
Protein status:BO27138.pep: Imported from assembly
Sequenced Size:982

Clone Sequence Records

BO27138.complete Sequence

982 bp assembled on 2010-09-17

GenBank Submission: KX799380

> BO27138.complete
GAAGTTATCAGTCGACATGGCCCGCATCGTTGAAAGCAATTTTGTGCCAC
TCGCCGTGGGTGTGGTAGCCGTACTCGCCGGCGCCCTGATCGTCCACTAT
CTGCTGAATAAGAAGTCCACGAAACCACGCCGGGAACCCAATCGCACCGC
TCGGCTGCGCACACTTGTGGATCCCAATGACAAGTACCTGCTGCCTCTCA
TCGAAAAGGAGAATCTGAGCCATGACACTAGGAGATTCCGGTTTGGATTG
CCCTCCAAGCAGCATGTCCTTGGCCTGCCCGTTGGCCAGCACATTCATCT
GATCGCCACCATCGACAATGAGCTAATAATTCGGCCATACACTCCGATAT
CGTCTGATGAGGATGTGGGCTACGTGGACCTAGTCGTCAAGGTGTACTTC
AAGGATTCGCATCCCAAGTTCCCGGCCGGCGGCAAAATGACACAACACCT
GGAGCAGCTCGAGTTGGGGGACAAGATCTCGTTCCGTGGTCCCTCGGGTA
GGCTACAATATCTCGGCAATGGCACCTTCTCCATCAAAAAGTTGCGCAAG
GATCCTCCAAAGCACGTGACCGCCAAGCGGGTCAACATGATTGCCGGCGG
CACTGGCATTACTCCAATGCTTCAATTGGCCAGGGAAGTTCTCAAGCGCA
GCGATAAGGATAAGACTGAACTGGCGTTGCTGTTCGCCAATCAGAGCGAA
AAGGACATTCTACTGCGTGCAGAGTTGGACGAACTGGCCCAGAAGCATCC
TGACCAGTTCAAGATCTGGTACACAGTCGACAAGGCAAACGAAGGTTGGC
AGTATAGCGTTGGCTTCATCAATGAGGAAATGATCGCCGCCCACCTGCTT
CCGGCCAAGGACGATACCATTGTGTTGCTTTGCGGCCCACCACCCATGAT
TAACTTTGCCTGCAATCCGGCGCTGGACAAGCTTGGCTACCATCCGGACA
CCCGTTTTGCCTACGCAAGCTTTCTAGACCAT

BO27138.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG5946-RF 951 CG5946-PF 1..948 17..964 4725 99.9 Plus
CG5946-RB 951 CG5946-PB 1..948 17..964 4725 99.9 Plus
CG5946-RA 942 CG5946-PA 14..939 39..964 4615 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5946-RF 1460 CG5946-RF 348..1296 16..964 4730 99.9 Plus
CG5946-RB 1686 CG5946-RB 286..1234 16..964 4730 99.9 Plus
CG5946-RA 1224 CG5946-RA 135..1060 39..964 4615 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:44:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11818254..11818907 694..41 3270 100 Minus
3L 28110227 3L 11817147..11817318 964..793 845 99.4 Minus
3L 28110227 3L 11818086..11818189 796..693 520 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:44:20 has no hits.

BO27138.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-20 11:04:46 Download gff for BO27138.complete
Subject Subject Range Query Range Percent Splice Strand
CG5946-RB 269..1216 17..966 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:27:43 Download gff for BO27138.complete
Subject Subject Range Query Range Percent Splice Strand
CG5946-RB 287..1234 17..966 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:17:16 Download gff for BO27138.complete
Subject Subject Range Query Range Percent Splice Strand
CG5946-RB 287..1234 17..966 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:17:16 Download gff for BO27138.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11821834..11821857 17..40 100   Minus
3L 11818254..11818907 41..694 100 <- Minus
3L 11818088..11818187 695..794 100 <- Minus
3L 11817145..11817316 795..966 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:27:43 Download gff for BO27138.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11814934..11814957 17..40 100   Minus
arm_3L 11811354..11812007 41..694 100 <- Minus
arm_3L 11811188..11811287 695..794 100 <- Minus
arm_3L 11810245..11810416 795..966 98 <- Minus

BO27138.pep Sequence

Translation from 16 to 982

> BO27138.pep
MARIVESNFVPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTL
VDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATID
NELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLEL
GDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITP
MLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKI
WYTVDKANEGWQYSVGFINEEMIAAHLLPAKDDTIVLLCGPPPMINFACN
PALDKLGYHPDTRFAYASFLDH

BO27138.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG5946-PF 316 CG5946-PF 1..316 1..316 1648 100 Plus
CG5946-PB 316 CG5946-PB 1..316 1..316 1648 100 Plus
CG5946-PA 313 CG5946-PA 1..313 4..316 1616 98.7 Plus
CG5946-PD 316 CG5946-PD 1..316 1..316 1513 90.5 Plus
CG5946-PG 330 CG5946-PG 1..330 1..316 1488 86.7 Plus