Clone BO27142 Report

Search the DGRC for BO27142

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptCG13564-RA
Protein status:BO27142.pep: Imported from assembly
Sequenced Size:277

Clone Sequence Records

BO27142.complete Sequence

277 bp assembled on 2010-08-18

GenBank Submission: KX797386

> BO27142.complete
GAAGTTATCAGTCGACATGTCCCATGAACCGCAGAAGCCCGCCAAGTCAG
CAGTGAAGGAGCCTCCGGTTGTGAGCGAGGAGACCAGAACCACGGACAAG
TGCCTGGCGGACTTTTGCTTGAAGGGTGGAAGTGGCCTGATCATCGGCAG
CGCGGTCACCTTGTTCTTCACGCGCCCACAAACCTATCCCATTTGGCTGG
GACTGGGCGTCGGTATGGGCGTGGCCTACGACTGCTGCCAGGCCCGCTGG
AATCAACAGGCAAGCTTTCTAGACCAT

BO27142.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13564-RA 246 CG13564-PA 1..243 17..259 1215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG13564-RA 500 CG13564-RA 99..341 17..259 1215 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24081023..24081265 17..259 1215 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:43:33 has no hits.

BO27142.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:27 Download gff for BO27142.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 99..341 17..261 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:31 Download gff for BO27142.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 99..341 17..261 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:11 Download gff for BO27142.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 99..341 17..261 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:11 Download gff for BO27142.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24081023..24081265 17..261 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:31 Download gff for BO27142.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19968546..19968788 17..261 99   Plus

BO27142.pep Sequence

Translation from 16 to 277

> BO27142.pep
MSHEPQKPAKSAVKEPPVVSEETRTTDKCLADFCLKGGSGLIIGSAVTLF
FTRPQTYPIWLGLGVGMGVAYDCCQARWNQQASFLDH

BO27142.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG13564-PA 81 CG13564-PA 1..81 1..81 441 100 Plus
CG12479-PA 74 CG12479-PA 14..66 27..79 150 50.9 Plus
CG41128-PB 72 CG41128-PB 17..69 27..79 141 45.3 Plus