Clone BO27145 Report

Search the DGRC for BO27145

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:45
Vector:pDNR-Dual
Associated Gene/TranscriptCG9825-RA
Protein status:BO27145.pep: Imported from assembly
Sequenced Size:1489

Clone Sequence Records

BO27145.complete Sequence

1489 bp assembled on 2010-09-20

GenBank Submission: KX796983

> BO27145.complete
GAAGTTATCAGTCGACATGACGGCCGAGACAAACAAAGGACCCGTTCTGG
GAATGAGGCATGTCCAGGCGCTACTGATCTTCCTCAATATAACTACCGTA
TTCATAGGCCGCCTAAATGTGGGCGTGTCTGTGGTGGCAATGACCAATGC
GGAAACCACGAACCCGAACTTTCCGGAATACGATTGGACGGAGGCAGAGA
AGTCGTACATTCTCTCCAGTTTCTTTTGGGGCTACATCCTAACGCAATTC
CTTGGAGGTTATCTCTGCAAGCGCTTTGGAGTCAAGAGTGTAATGTTTTG
GGGTGTCTTCGGATCTGGTGTCTGCAGTGCTTTGACGCCGCTGTTCATCG
GATTTGGAGAATGGCAGGCCTACTGTGGAATTCGAGTTCTAATGGGATTG
GCCCAGGGAGTGGTATTCCCCTGCATTCATCAGCACCTGGCTAAATGGTC
ACCGCCCGAGGAAAGAAATCGGTTGGGAGCTCTGAGTCACACTGGAATCG
AGTGCGGCAATGTGAGTGCCATGTTCCTGAGCGGAATGATAGCCAAGAGC
TCCCTGGGATGGCCCGGAATCTCATATGTCTCGGCTGGAGTGGCCTTCTT
CTGGTGTACATTATGGTTCGTCTTCGCTGCCAACCATCCTACGGAATCTC
GTTTCATAGGAGAGAACGAACTGATCTATATTGAGTCGTCTCTAAAGCAC
AATGAGTCATACCACGCTACCATTATACCCATTCCCTGGAAGGCAATTTG
GACGTCGGCACCATTCCTGGCCCTGCTCATAGTACGATGCGCTGAGAACT
GGGGACTGAGCACTCTGCAGGCCGAGATCCCATCCTATATGAACGGAGTC
CTCGACATGGACATGAAGAGCAATGCGTTCTTCTCGGCACTCCCATTCTT
GGCCATGTGGTGCATGTCGTATATTTACCTAGTCGTAGCCGATGTGCTCT
TGGGCAAGAACTCGGTGTCCTTGACGATTTTGAGAAAGACCTACAACTCC
ATTGCCTTCTGGATTCCTGCTGCCACTTTGGTGGGCATTGGCTTTTTGGA
CAAGGAACAAAAGAACTTCGCGATTGCTCTGATGACCATCAGTGTGGGCG
TGAATAGTGCTCAAACCATTGGCAGTGTTTTAAACACAATTGATCTATCG
AAAAATCACGCTAGCATTCTAATGGGAATTGTGAATACAGCGGCGAATTT
CGTGCCCATAGTCACTCCTTTAGTTGTTGGATGGATTGTTAAGGAAAATT
CTGATCGCTCCCAATGGCAGATCGTGTTCATCATTGCCTCCGTAATCTTC
TTTGTGGGCAATTGCATTTACTTGGTGTTTGGCACGGCCGAAACTCAGCC
CTGGGATGCCGAGGACTATCTGCAGACACAGAACCCGGAACTTGCCAATA
GACCACCTATGCAGGCGTTATCCTTTCCAATTAACGAAAATTCCAAAGAG
AAAATTAATAGTAAAAGCCATGCAAGCTTTCTAGACCAT

BO27145.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9825-RA 1458 CG9825-PA 1..1455 17..1471 7275 100 Plus
CG12490-RB 1440 CG12490-PB 1..1271 17..1287 2650 80.6 Plus
CG30265-RB 1458 CG30265-PB 1..1352 17..1368 1660 74.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG9825-RA 1543 CG9825-RA 76..1530 17..1471 7275 100 Plus
CG12490-RB 1647 CG12490-RB 54..1324 17..1287 2650 80.6 Plus
CG30265-RB 1622 CG30265-RB 58..1409 17..1368 1660 74.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22837915..22838989 175..1249 5375 100 Plus
2R 25286936 2R 22835185..22836241 175..1231 1850 78.3 Plus
2R 25286936 2R 22833119..22834175 175..1231 1595 76.7 Plus
2R 25286936 2R 22839057..22839278 1250..1471 1110 100 Plus
2R 25286936 2R 22834990..22835129 37..176 700 100 Plus
2R 25286936 2R 22837720..22837859 37..176 700 100 Plus
2R 25286936 2R 22841605..22841790 725..910 315 78 Plus
2R 25286936 2R 5962261..5962374 946..833 195 78.1 Minus
Blast to na_te.dros performed on 2014-11-28 07:40:47 has no hits.

BO27145.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-22 09:24:17 Download gff for BO27145.complete
Subject Subject Range Query Range Percent Splice Strand
CG9825-RA 74..1528 17..1473 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:28:45 Download gff for BO27145.complete
Subject Subject Range Query Range Percent Splice Strand
CG9825-RA 76..1530 17..1473 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:01:36 Download gff for BO27145.complete
Subject Subject Range Query Range Percent Splice Strand
CG9825-RA 76..1530 17..1473 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:01:36 Download gff for BO27145.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22839057..22839278 1250..1473 99   Plus
2R 22837916..22838989 176..1249 100 -> Plus
2R 22837722..22837858 39..175 100 -> Plus
2R 22837436..22837457 17..38 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:28:45 Download gff for BO27145.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18726580..18726801 1250..1473 99   Plus
arm_2R 18725439..18726512 176..1249 100 -> Plus
arm_2R 18725245..18725381 39..175 100 -> Plus
arm_2R 18724959..18724980 17..38 100 -> Plus

BO27145.pep Sequence

Translation from 16 to 1489

> BO27145.pep
MTAETNKGPVLGMRHVQALLIFLNITTVFIGRLNVGVSVVAMTNAETTNP
NFPEYDWTEAEKSYILSSFFWGYILTQFLGGYLCKRFGVKSVMFWGVFGS
GVCSALTPLFIGFGEWQAYCGIRVLMGLAQGVVFPCIHQHLAKWSPPEER
NRLGALSHTGIECGNVSAMFLSGMIAKSSLGWPGISYVSAGVAFFWCTLW
FVFAANHPTESRFIGENELIYIESSLKHNESYHATIIPIPWKAIWTSAPF
LALLIVRCAENWGLSTLQAEIPSYMNGVLDMDMKSNAFFSALPFLAMWCM
SYIYLVVADVLLGKNSVSLTILRKTYNSIAFWIPAATLVGIGFLDKEQKN
FAIALMTISVGVNSAQTIGSVLNTIDLSKNHASILMGIVNTAANFVPIVT
PLVVGWIVKENSDRSQWQIVFIIASVIFFVGNCIYLVFGTAETQPWDAED
YLQTQNPELANRPPMQALSFPINENSKEKINSKSHASFLDH

BO27145.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG9825-PA 485 CG9825-PA 1..485 1..485 2557 100 Plus
CG12490-PB 479 CG12490-PB 1..463 1..463 2064 82.5 Plus
CG30265-PB 485 CG30265-PB 1..485 1..485 1994 75.5 Plus
CG30265-PA 485 CG30265-PA 1..485 1..485 1994 75.5 Plus
CG9826-PC 495 CG9826-PC 1..464 1..464 1635 63.1 Plus