Clone BO27162 Report

Search the DGRC for BO27162

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG15525-RA
Protein status:BO27162.pep: Imported from assembly
Sequenced Size:517

Clone Sequence Records

BO27162.complete Sequence

517 bp assembled on 2010-08-18

GenBank Submission: KX796232

> BO27162.complete
GAAGTTATCAGTCGACATGGGCATGATGGACAACAATGGCGTCGGCAAGC
TGACACAAGAATCTCTAAAACGCAAGGAGCGTCTGCAAAAACTCCGGGAA
CAAGTGCAAAACAAAGGAGGAGACGCTGCCGAGTCCATTGAAAAGTTACC
CAAACCAGTTTTCCGCAGCTACAAGCCCCAGAATGAGACCACCGATGGCG
AGATTCTAGCACAGGAACCCACGGGCAACATAGAATCAGCTGTGGAGGAT
CAATTGAGTCTGCTCCAGCAGCCCATGGTGATAGATGAGATTGACATAAC
CAACCTGGCTCCCCGAAAACCCGACTGGGATCTGAAGCGGGATGCCAGCA
AAAAGTTGGAGCGACTGGAACGACGTACCCAGAAAGCTATTGCTGAACTC
ATCCGTGAGCGACTGAAACTGAACCAAATGGAGGATATCAGCCAAGCGGT
GAATGTGGCCACGGCTCATGCAGGTGAAAGTGTTCAGGAGGATTATGACG
CAAGCTTTCTAGACCAT

BO27162.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG15525-RA 486 CG15525-PA 1..483 17..499 2415 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG15525-RA 654 CG15525-RA 101..585 15..499 2425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29997030..29997375 499..154 1730 100 Minus
3R 32079331 3R 29997438..29997576 153..15 695 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:43:03 has no hits.

BO27162.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:17 Download gff for BO27162.complete
Subject Subject Range Query Range Percent Splice Strand
CG7911-RB 579..1061 17..501 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:21 Download gff for BO27162.complete
Subject Subject Range Query Range Percent Splice Strand
CG15525-RA 103..585 17..501 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:03 Download gff for BO27162.complete
Subject Subject Range Query Range Percent Splice Strand
CG15525-RA 103..585 17..501 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:03 Download gff for BO27162.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29997438..29997574 17..153 100   Minus
3R 29997028..29997375 154..501 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:21 Download gff for BO27162.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25823160..25823296 17..153 100   Minus
arm_3R 25822750..25823097 154..501 99 <- Minus

BO27162.pep Sequence

Translation from 16 to 517

> BO27162.pep
MGMMDNNGVGKLTQESLKRKERLQKLREQVQNKGGDAAESIEKLPKPVFR
SYKPQNETTDGEILAQEPTGNIESAVEDQLSLLQQPMVIDEIDITNLAPR
KPDWDLKRDASKKLERLERRTQKAIAELIRERLKLNQMEDISQAVNVATA
HAGESVQEDYDASFLDH

BO27162.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15525-PA 161 CG15525-PA 1..161 1..161 808 100 Plus