Clone BO27165 Report

Search the DGRC for BO27165

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG14131-RA
Protein status:BO27165.pep: Imported from assembly
Sequenced Size:2239

Clone Sequence Records

BO27165.complete Sequence

2239 bp assembled on 2010-10-15

GenBank Submission: KX795969

> BO27165.complete
GAAGTTATCAGTCGACATGGCCCAGCTGAAGAATGTGGGCCAAGCAGGTC
AACAGGCCGTTCTTGTTGTTGGCCCCATGCTTGCCTCGGCCATGTTGCTC
ATGGGGCTGATATTCGCGCTGCTGGGGATCAAGTTCTTCGGCTTCCGGCG
GCGACTGACTTTCGAGCGATCGCAGGTGCAGCGGCAACAGCAGAATCAGC
AGCAGCAACAACCGCCGCCACGTTACGCAGCTTTCGAATCGCAGGTTAAC
GGCACCGATACTGCTGTCCATGGAGTGTTCCGACGTCGCAATCTCGAGGA
ATTCGAAAGCCCATGGCCATCGGCATCAGCAACGACAGGGAACAACTTCA
TCAGTGGCAGTGTTCCAAATCTGCAACTATATGGCGCCAGCCCAAGACAG
CCCAAATCCACGGAAGAATCACCAGTTTCCTATCGAGAGAAGTCGGAGGC
ACAACGACTGGAGGTGCACAGTGAGCACTATGAATTCTACACCGCTCCAC
CTACCCGCAAGCCACCTTCTCCGCCACTACAATCAGAAGTACTAGCTGAA
ACTGCCTCGGTAGTTTCACTACCTAAGATACTAGAATCCATCCCTGCTCC
ACCTCCCAGGACCATGAGAGGAGCTGCTGCATCCAAGCCTTCAGGACCTG
CAGCTTCTGTCGACACAGCTCCCGAGCCTCCTAGCGAACTGGGAATGCCC
AACTTCGATCACTTTGCTGAAAAGTACGAGTTGTTTAGTGTAAAACCAAC
GACTGCGCCCACTAGACCAACACAGTTGCGAAGCAAGAACAGCGGCCGCT
ATGTGAAGTTCGAGCCAGTTGATGATGTGCCGGAAATTCTCACTCCTGAG
GATCCCGTTCCGGAGTTACTAACTCCAGATGATGGTTTGGGAGGAGCGAT
GTCAGTTACCGCTGTGGTTCATAGGGGAGCCATACCCAAGGAAGAAACGG
AATCGAAAGATGAACCGCAAGCACCAAATGATACCGATCCCTTTGGGGGA
CCCAGCAATACAGACTCAGCTTTTGTCGTGGAAATCATAGCAGGAAGTCC
CGAAGCGGAAGCGACTCCTAGTATACAGCCCACCTTTCAAAATGGCCTAT
TTGAAAACCTTGAATTACCACAAGGTGAGCACGACAGTGATTTCGTGCGA
ATACGTTCGTCATTCGTGATGAACGAAGCCGACATCCTGGATTTGGATCA
GCTGCAGCTGCCGGCGGCCAGTAGTCCACCAGGATTTGGCAAGAGCATCG
ACGAGGACTGGGAGAACTTTGCCAACCTAGACGCCGTGGTGGATGTGCCA
GAGCCCAATTGGTCTCTGCATCCGAATAGCTTAGAGCAAGTGCCCACTGT
GGAGGCGACGCTTAATGAGGCTGCCGTCAGACTGGACGATGTGGAACAGG
TGGAGGGTCTGTTCCATCAACTAGAGCTTATAGAGCCGAGAATGGATATA
TTCGAGCCTGAGCCGCCAGCTCCCATTATAAATCCACCGCCATACGATCC
TGGTCTGCCCTATCTACCAGATTACGAATCCCTGATGCGGCTAGATATTG
CAAAGAACGGTCAGAAATTGCCCGACTACACCGAGGTAATGCAACAAAGG
TCCAAGACATCCAATTATGTAATGAGCATTGAGGATCTATACGCGGATCT
GGATGTTAATGAGGTGGAGATAAACGGTTCTCAAGTCAACCAGAGCAATG
AAATCCCCAATTTCGAGGCCTTGTGCCAGGAAATGGCTGTGGTGGTGCCA
TCAGAGCGTCAAGCTCCTCAGCCCGCGCCCAGGTCTACCAAATCAGCCAG
ATCCCTCAATGTTCGTGGTAGTACTTCTCCCCTTGCGTGCTATCAACCTG
AAGAGCTTCCCAGCTCCAGTTCCAGTGATACCGATGGGGAGGAGGGAGCA
CGATCAGCTCCAGAACCTGCCAAACGTGATCCGAAATCGCTCAAAGTCCG
CTTTGATGTGGATAATCTGCAGTACTACCAGTCCGCTGAGGTGGTAACAT
CAGGTGATGAGTCTGAAGAGGATGAGCCGATGCAACAGCCAACTCCCACG
CAGCGTTCGATCATTTTTGAACCGAGTAATACTGGAGTGCCCAGCCTATT
CGGATCCCAGGTCTCCCAGGAAGACAGTGATGACGATAATGGCTTTGGAC
GAGCTATCAGCCAACATCGCTCCATGACTGCGACACTTAGGACAAACGCT
GTTAGAAACAATACCGATGACGCAAGCTTTCTAGACCAT

BO27165.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14131-RA 2208 CG14131-PA 1..2205 17..2221 11025 100 Plus
CG14131-RB 2205 CG14131-PB 1..2202 17..2221 10945 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14131-RA 2532 CG14131-RA 147..2354 14..2221 11040 100 Plus
CG14131-RB 2529 CG14131-RB 147..2351 14..2221 10960 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11778422..11780307 336..2221 9430 100 Plus
3L 28110227 3L 11777304..11777507 43..246 1020 100 Plus
3L 28110227 3L 11778215..11778312 242..339 490 100 Plus
Blast to na_te.dros performed 2014-11-26 15:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1087..1145 172..231 162 76.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2602..2662 165..225 161 73.8 Plus
roo 9092 roo DM_ROO 9092bp 1104..1151 165..212 150 79.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6778..6821 178..221 148 81.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6805..6851 172..218 145 78.7 Plus
roo 9092 roo DM_ROO 9092bp 1099..1148 172..221 142 76 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6881..6923 173..215 134 79.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2377..2424 165..212 132 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1539..1575 179..215 131 83.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2330..2373 172..215 130 77.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6736..6770 178..212 130 85.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..6791 178..212 130 85.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1513..1551 174..212 123 79.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2438..2472 178..212 121 82.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2480..2514 178..212 121 82.9 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 972..1056 179..263 119 60 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2773..2826 165..218 117 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2305..2352 183..231 116 73.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6824 172..212 115 75.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2812..2868 165..221 114 66.7 Plus

BO27165.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:10 Download gff for BO27165.complete
Subject Subject Range Query Range Percent Splice Strand
CG14131-RA 1..2205 17..2223 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:48 Download gff for BO27165.complete
Subject Subject Range Query Range Percent Splice Strand
CG14131-RA 150..2354 17..2223 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:21 Download gff for BO27165.complete
Subject Subject Range Query Range Percent Splice Strand
CG14131-RA 150..2354 17..2223 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:21 Download gff for BO27165.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11778425..11780307 339..2223 99   Plus
3L 11778218..11778311 245..338 100 -> Plus
3L 11777306..11777505 45..244 100 -> Plus
3L 11777222..11777249 17..44 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:48 Download gff for BO27165.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11771525..11773407 339..2223 99   Plus
arm_3L 11771318..11771411 245..338 100 -> Plus
arm_3L 11770406..11770605 45..244 100 -> Plus
arm_3L 11770322..11770349 17..44 100 -> Plus

BO27165.pep Sequence

Translation from 16 to 2239

> BO27165.pep
MAQLKNVGQAGQQAVLVVGPMLASAMLLMGLIFALLGIKFFGFRRRLTFE
RSQVQRQQQNQQQQQPPPRYAAFESQVNGTDTAVHGVFRRRNLEEFESPW
PSASATTGNNFISGSVPNLQLYGASPRQPKSTEESPVSYREKSEAQRLEV
HSEHYEFYTAPPTRKPPSPPLQSEVLAETASVVSLPKILESIPAPPPRTM
RGAAASKPSGPAASVDTAPEPPSELGMPNFDHFAEKYELFSVKPTTAPTR
PTQLRSKNSGRYVKFEPVDDVPEILTPEDPVPELLTPDDGLGGAMSVTAV
VHRGAIPKEETESKDEPQAPNDTDPFGGPSNTDSAFVVEIIAGSPEAEAT
PSIQPTFQNGLFENLELPQGEHDSDFVRIRSSFVMNEADILDLDQLQLPA
ASSPPGFGKSIDEDWENFANLDAVVDVPEPNWSLHPNSLEQVPTVEATLN
EAAVRLDDVEQVEGLFHQLELIEPRMDIFEPEPPAPIINPPPYDPGLPYL
PDYESLMRLDIAKNGQKLPDYTEVMQQRSKTSNYVMSIEDLYADLDVNEV
EINGSQVNQSNEIPNFEALCQEMAVVVPSERQAPQPAPRSTKSARSLNVR
GSTSPLACYQPEELPSSSSSDTDGEEGARSAPEPAKRDPKSLKVRFDVDN
LQYYQSAEVVTSGDESEEDEPMQQPTPTQRSIIFEPSNTGVPSLFGSQVS
QEDSDDDNGFGRAISQHRSMTATLRTNAVRNNTDDASFLDH

BO27165.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:13:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG14131-PA 735 CG14131-PA 1..735 1..735 3809 100 Plus
CG14131-PB 734 CG14131-PB 1..734 1..735 3793 99.9 Plus