Clone BO27178 Report

Search the DGRC for BO27178

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG31682-RA
Protein status:BO27178.pep: Imported from assembly
Sequenced Size:991

Clone Sequence Records

BO27178.complete Sequence

991 bp assembled on 2010-09-22

GenBank Submission: KX799950

> BO27178.complete
GAAGTTATCAGTCGACATGGAAGCGCCGGTGAAGGGCATTATTGGTATTC
TGGCCACTGCTGGATCGTTTTTTGCACTAGGAGCTTACTATCAGCACATC
GATGTCATGCGAAAGATTCGACGATTGGAGCAACGAAACCCACATGCCTA
CTTTATCAGAAGGAAACTGTACGCACTGCTGGGAATTTTCGCTGTGCGCC
CTGATAACTCAGAATTCGACGTGGATACCGATGACTGCCACAAGCTGGGC
GGGATCATGAAGTACGGCTTCCCCAGCACCAATGATATCACCATAAATGA
GACCTTTGACTTTGTGACCTCTTTCGATCGAAGAAACTCTGCGATTCTGT
GGATGTGCGAGCGGGTAGATCTGTCCAATCGCGTCGTCTACGGGGATTCC
ACATCCGTGGCTCCAGCTGGAGCATTTGGACAGTCGGAGGCAGCCAGGGT
ATTTTTCCTGTCCAACATTAGGCCCTTTCTAAACAGAGGGTTCAATCTCA
CTGTCTGGGATCGACTGCTGCAGTACGTCCATGAGATGAGTCAACGACAT
GGAACCGTGTATGCCTACACCGGATCAATTTACTTGCCCCGGGAGCTAAA
GTCGAACAGTTGGTTCCTGGAGTTCCAGTCGGAGGAGAGAACCATGGTGG
CCGTACCCACCCATTTCTTCAAGATCCTGGTCATTGATAAGAAGTTCGCG
GGCGATACCATTCCCTATGCGGAGGCCTATGTGATGCCCAACTCTCCGCT
GAACAACAATGTCGAACTGAAGACGCTTCTCAGCGATGTCCGGGAAATAG
AAAACGCTACTGGTCTACGGTTCTTTGAAGGACTCGACCGCAACTTTGTC
AACACCCAAGCATCAAATTCATTTGTCCCCTCAGTAAACGGTCCTTTAAC
AAATCCGTTAACGTTGCCGATGACTAATGCCTTAGACAGTCACAGTGCCC
TCACATCAAGTATTTCTCCAAAAGCAAGCTTTCTAGACCAT

BO27178.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Tengl1-RA 960 CG31682-PA 1..957 17..973 4785 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Tengl1-RA 1108 CG31682-RA 92..1048 17..973 4785 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2239474..2240269 973..178 3980 100 Minus
2L 23513712 2L 2240341..2240502 178..17 810 100 Minus
Blast to na_te.dros performed on 2014-11-28 07:45:52 has no hits.

BO27178.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-22 09:24:25 Download gff for BO27178.complete
Subject Subject Range Query Range Percent Splice Strand
CG31682-RA 92..1044 17..969 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:20 Download gff for BO27178.complete
Subject Subject Range Query Range Percent Splice Strand
Tengl1-RA 92..1044 17..969 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:03:18 Download gff for BO27178.complete
Subject Subject Range Query Range Percent Splice Strand
Tengl1-RA 92..1044 17..969 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:03:18 Download gff for BO27178.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2240341..2240502 17..178 100   Minus
2L 2239478..2240268 179..969 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:20 Download gff for BO27178.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2240341..2240502 17..178 100   Minus
arm_2L 2239478..2240268 179..969 100 <- Minus

BO27178.pep Sequence

Translation from 16 to 991

> BO27178.pep
MEAPVKGIIGILATAGSFFALGAYYQHIDVMRKIRRLEQRNPHAYFIRRK
LYALLGIFAVRPDNSEFDVDTDDCHKLGGIMKYGFPSTNDITINETFDFV
TSFDRRNSAILWMCERVDLSNRVVYGDSTSVAPAGAFGQSEAARVFFLSN
IRPFLNRGFNLTVWDRLLQYVHEMSQRHGTVYAYTGSIYLPRELKSNSWF
LEFQSEERTMVAVPTHFFKILVIDKKFAGDTIPYAEAYVMPNSPLNNNVE
LKTLLSDVREIENATGLRFFEGLDRNFVNTQASNSFVPSVNGPLTNPLTL
PMTNALDSHSALTSSISPKASFLDH

BO27178.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Tengl1-PA 319 CG31682-PA 1..319 1..319 1660 100 Plus
Tengl2-PA 318 CG32463-PA 13..300 8..276 460 34.2 Plus
Tengl4-PA 378 CG4683-PA 128..362 72..276 303 29.7 Plus
Tengl3-PA 337 CG31679-PA 22..325 19..294 270 27.3 Plus
EndoG-PA 310 CG8862-PA 1..304 1..280 260 27.1 Plus