Clone BO27185 Report

Search the DGRC for BO27185

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptRpp20-RA
Protein status:BO27185.pep: Imported from assembly
Sequenced Size:535

Clone Sequence Records

BO27185.complete Sequence

535 bp assembled on 2010-08-18

GenBank Submission: KX794341

> BO27185.complete
GAAGTTATCAGTCGACATGATGGGAAGCAATTATCCCGAGCACGGGACCA
AGCCGAGATCCGCCAAATACCACAAACAACAGAACCACCGAGTGGTGCGC
AAGCAGCCGCCGCGTCCCGCTGTTAGCGACCGCCACAACATCTACATCAC
CAGCAAGACAGACTTTAAGGCCCAGCAGCGCCGCTGCGAGGAGCTGATTA
ACTCCGGCGCCCACGAGATCTTTCTGCATTGCATGGGCTTCTCCGTAACC
CGCGGCCTCAATATCGCCCTACGCCTCGTCCAGAATTCTGACGGCGCCCT
TAGCTACGCCATCAACACCTCCACCGTTCAGCTGGTGGACGAACTGCACC
CGCTGTGCGATGCCGAGGACATAACCTTCCGCCAGCGCAACAACTCGGCC
CTGCACATCAAGATCCTCAATAACAGTCTCTTCGACATCGCCGTGCCGCA
ACCGTCGCAGTCCCAGACGCAAGCCCAGTCCCTGGGCCAGTTCCGAGGCA
AGGCGAAGGCCAGGCAGGCAAGCTTTCTAGACCAT

BO27185.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp20-RB 504 CG33931-PB 1..501 17..517 2505 100 Plus
Rpp20-RA 504 CG33931-PA 1..501 17..517 2505 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp20-RB 1395 CG33931-RB 99..599 17..517 2505 100 Plus
Rpp20-RA 1244 CG33931-RA 99..599 17..517 2505 100 Plus
CG33932-RB 1395 CG33932-RB 99..599 17..517 2505 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19744753..19745102 168..517 1750 100 Plus
X 23542271 X 19744529..19744683 17..171 775 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:41:44 has no hits.

BO27185.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:57 Download gff for BO27185.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 97..597 17..519 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:54 Download gff for BO27185.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 99..599 17..519 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:35 Download gff for BO27185.complete
Subject Subject Range Query Range Percent Splice Strand
CG33932-RB 99..599 17..519 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:35 Download gff for BO27185.complete
Subject Subject Range Query Range Percent Splice Strand
X 19744761..19745102 176..519 99   Plus
X 19744529..19744685 17..175 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:54 Download gff for BO27185.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19638794..19639135 176..519 99   Plus
arm_X 19638562..19638718 17..175 98 -> Plus

BO27185.pep Sequence

Translation from 16 to 535

> BO27185.pep
MMGSNYPEHGTKPRSAKYHKQQNHRVVRKQPPRPAVSDRHNIYITSKTDF
KAQQRRCEELINSGAHEIFLHCMGFSVTRGLNIALRLVQNSDGALSYAIN
TSTVQLVDELHPLCDAEDITFRQRNNSALHIKILNNSLFDIAVPQPSQSQ
TQAQSLGQFRGKAKARQASFLDH

BO27185.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp20-PB 167 CG33931-PB 1..167 1..167 869 100 Plus
Rpp20-PA 167 CG33931-PA 1..167 1..167 869 100 Plus