Clone BO27191 Report

Search the DGRC for BO27191

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptDref-RA
Protein status:BO27191.pep: Imported from assembly
Sequenced Size:2161

Clone Sequence Records

BO27191.complete Sequence

2161 bp assembled on 2010-10-15

GenBank Submission: KX797864

> BO27191.complete
GAAGTTATCAGTCGACATGAGCGAAGGGGTACCAGCGTCGCCCGTGGCCA
TTGGCGAACTCAAGTACGAGGATGTGTCGCAGCTAAATTTTTCCAAACTG
TACTCGCCCAAGATGAAAAGCGTATACTGGCGCTACTTTGGATTCCCCTC
GAACGACAATAATGAGGTGATTACCAAACAGAATGTGGTCTGCATTAAGT
GTCACAAGGTGCTGACCAACCATGGCAACACCACCAATTTGCGTGCGCAT
CTCCAGCACCGACACAAGGATCTGTTCAAGGAGCTGTGCCAGGAGCACGA
CATCCATGTGCCGCCGCGCAAGACGCCGCGTAATGTATCCCATCCACCGC
TGTCCAAGCGGAATGTTTCCTCGCGGCGGGTCAAACTGGAGTTCATTAAT
AACCGGAACCACGATAACGCTTCCGATGATGAACTGGACGAAGCAGCCGT
GGCAACTGCGGCCATGCAGGCGGAGGAGGACGCCTCCTCGCAAACCATGC
TGTACGAGACCATGGTGCCCTTCACCTACGACGAGGCCGAAAATCTGGTA
GAGGAGGAGGAGCGCCTAGTTATGGAACCAAAGTACGGACGCAAACGCAA
AGTGGCCACTCCATCGAGTGCCCTGATGCACGGGCGTGTCATCAAGCACG
AGGAAGGCGGCTATGCCGCCGTGGCGAACATCGCCAATCTGGCCGAAGCC
CTTACGGACATTGTGATTAAGGATTTGCGCAATGTGGATTCTCTGTACGA
TGCCGGTTTTGGTGAATTCCTGCGTCAAGTCCTAGGCAATTCGGCAGCCA
TGCCCGAGCCACACAAGATCGACTCTTTGATCAATGAGATGCACGCCTCC
AAGTTTCTGGAGATTGGCGAAATCACGCGCGATTTCACCTCCGAGAAGCC
CTTCTCTCTCGCCTTTGAGATGTGGGTGAATGTTGAACAGCGGCGCTTCC
TTAGCATCTTCCATCACTTTCTGGACGAGGAGACGCACTCAGTTCGCGGT
ATGCTGTATGCCACCGTGGAGTACAACGACTACATCGTCTTTGACGATCT
GCTGACCGACTTCTATTTGGCCAATTGCACACTGGCCATCATAAACTACG
ACGAGGAAGAGGACCTTTTGCACACCTATCTGCGAGAGAAAAATATACCC
ATTTCGCTGTGCTACGTTTCGGTAATTGACAAATGTTTGCGTCGTGTGTT
TGAGATCGAAGAGGTGGCCACTTTATTGGAGCAGGTGAAGGACCTAATGC
AGCGTCATTCAACGGAGATTGCCTCCAAGGTGTCCGAGGTGCCCATGCCC
ACGTACAACGAGCACTTCCCCTGGACACTGTACGAAACATTGAAGTTCTT
TGCCGAGTCCATATCTTGGTCCGAGGACATGGATCACCTGGTTATATCAG
CCAAGACGGTGACGGAGGCCCTGAGTGCTCTGGTGATTGCTTTGGACACG
CTGCGTGGCGAAGACATTCCCTTGTGTAGCATGCTTTCGCCAATCACTTC
AAAGATTCTTATCAAGAAGTTGGGCATCGCCGAGCAGGACGATCCCCTAA
TGATGAATTTGAAGCGGACCATTTCCAGTGTCCTCCAGGCGCACGTTATA
TCCAATGACAATCTGACCGCTGCTGCATTGTTGGACCCACGCTTCCACCG
CCTGACCACCATTGACAACCTAGAGCGAACCGTTCGTATGCTGACCCATA
AGTATAACATTAACTTTGGTGGAGTGGGCGAAGGGGAATCCAACGAAGTG
GCAGCTACCTCCAGCGTGGTGGCCATTAAGTCAGAACCAAGAGTAGTGGA
CGGCAGTGCACCAAAGAAGTTGGGTCTGAAACTGCTGTTTGACAGTAACG
AGATACCAAATCCTCCGAAGCGAGATGCGGACAGCAGCGTGGAGTCCGAT
CTTAAGCGATATCGCAACGAGGTGGTCGTTCAGCTGGATGAGTCGCCCAT
CGAGTGGTGGCTCAAGATGGGACACATTTATGGAACGCTCCGCGATTTGG
CCAGCCTGTACCATAGTGTGCCCGGCGTGGTGACGCTCAGCTTCAAGAAG
GCGCTGAGAGACCAAATATACGACTTCAACAAGCGATTCATGCTCACCGG
TAGTCACATCGACGCCATCCTCTTTCTTCATCATCACAACAATGCAAGCT
TTCTAGACCAT

BO27191.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dref-RB 2130 CG5838-PB 1..2127 17..2143 10635 100 Plus
Dref-RA 2130 CG5838-PA 1..2127 17..2143 10635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dref-RB 2739 CG5838-RB 345..2471 17..2143 10635 100 Plus
Dref-RA 2872 CG5838-RA 345..2471 17..2143 10635 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9965760..9966885 1142..17 5630 100 Minus
2L 23513712 2L 9964926..9965316 1825..1435 1955 100 Minus
2L 23513712 2L 9964548..9964868 2143..1823 1605 100 Minus
2L 23513712 2L 9965376..9965668 1435..1143 1465 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:05:07 has no hits.

BO27191.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:08 Download gff for BO27191.complete
Subject Subject Range Query Range Percent Splice Strand
Dref-RA 571..2697 17..2145 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:41 Download gff for BO27191.complete
Subject Subject Range Query Range Percent Splice Strand
Dref-RA 345..2471 17..2145 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:13 Download gff for BO27191.complete
Subject Subject Range Query Range Percent Splice Strand
Dref-RA 345..2471 17..2145 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:13 Download gff for BO27191.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9965760..9966885 17..1142 100   Minus
2L 9965376..9965668 1143..1435 100 <- Minus
2L 9964928..9965315 1436..1823 100 <- Minus
2L 9964546..9964867 1824..2145 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:41 Download gff for BO27191.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9965760..9966885 17..1142 100   Minus
arm_2L 9965376..9965668 1143..1435 100 <- Minus
arm_2L 9964928..9965315 1436..1823 100 <- Minus
arm_2L 9964546..9964867 1824..2145 99 <- Minus

BO27191.pep Sequence

Translation from 16 to 2161

> BO27191.pep
MSEGVPASPVAIGELKYEDVSQLNFSKLYSPKMKSVYWRYFGFPSNDNNE
VITKQNVVCIKCHKVLTNHGNTTNLRAHLQHRHKDLFKELCQEHDIHVPP
RKTPRNVSHPPLSKRNVSSRRVKLEFINNRNHDNASDDELDEAAVATAAM
QAEEDASSQTMLYETMVPFTYDEAENLVEEEERLVMEPKYGRKRKVATPS
SALMHGRVIKHEEGGYAAVANIANLAEALTDIVIKDLRNVDSLYDAGFGE
FLRQVLGNSAAMPEPHKIDSLINEMHASKFLEIGEITRDFTSEKPFSLAF
EMWVNVEQRRFLSIFHHFLDEETHSVRGMLYATVEYNDYIVFDDLLTDFY
LANCTLAIINYDEEEDLLHTYLREKNIPISLCYVSVIDKCLRRVFEIEEV
ATLLEQVKDLMQRHSTEIASKVSEVPMPTYNEHFPWTLYETLKFFAESIS
WSEDMDHLVISAKTVTEALSALVIALDTLRGEDIPLCSMLSPITSKILIK
KLGIAEQDDPLMMNLKRTISSVLQAHVISNDNLTAAALLDPRFHRLTTID
NLERTVRMLTHKYNINFGGVGEGESNEVAATSSVVAIKSEPRVVDGSAPK
KLGLKLLFDSNEIPNPPKRDADSSVESDLKRYRNEVVVQLDESPIEWWLK
MGHIYGTLRDLASLYHSVPGVVTLSFKKALRDQIYDFNKRFMLTGSHIDA
ILFLHHHNNASFLDH

BO27191.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dref-PB 709 CG5838-PB 1..709 1..709 3668 100 Plus
Dref-PA 709 CG5838-PA 1..709 1..709 3668 100 Plus