Clone BO27192 Report

Search the DGRC for BO27192

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptCG10616-RA
Protein status:BO27192.pep: Imported from assembly
Sequenced Size:1510

Clone Sequence Records

BO27192.complete Sequence

1510 bp assembled on 2010-09-22

GenBank Submission: KX795551

> BO27192.complete
GAAGTTATCAGTCGACATGCGCACAGTGCTGTTGAGCAAACACGACGAGC
TGTACCTGGAGAAATGCGCACAGGAGAACCAGTTCTCGTACGGGATAATC
GTGGGCCATCAAGCGGATCTCACCAAGAGCGTGGTGGTCCACCTGGCCAG
GAACAACGAGGAGGATGCGGATCTGGAGGACCTGTCGGAGGTCCGGCTCA
CCATCTCGGACATCAACTCACAGGCATTGGCCTCCCAGTGGCTGAGCGCC
AGCAAAATGTGTCCCGGATCTTTTGACGTCATCGGAATCTTTGTGTCTTC
AGTAAGATCCGATGTAGTAAACGAACAGAGCGCCGAATTTAAGAATGCCA
AAAAGCTGTTTTCAGATATTTACGATTTGCTCCTGAAAAGCAACAGCTCG
TTTGGCGTCTACACCACCGACATTGCACAGACTGATTTCGTATTCCTCTC
GTATTCGCTGGCCGACAAGAAAGTGCTCTGCAAGAACTACAGCTATGGCA
ACGGCGGCACTTTCACCAATATGGAGTTCCGGTTTGTGGACAAACCCTTC
GAGTGGATTCAGCTGGAGTGCAGCTACGATTTCGATGATGTGCTGCCCAT
ACTGGACTCCTCGCGTCGCGTCAACATCGAAGACCAGTTCCAGAGTATGA
TAGTGTCGGTGCGCAAGAACCTGCTCGCCAGTGAAGTATTCCTCCAAAAC
GAAGTTGTCGAGGACACCATCGATCTGCAGGCCTATATCAAAAAGAAAAA
GACGAAAGTGGACAAGCTGCAACCGACATCGACAACAGGTGGCACGGCCA
CTGCCTCGAGCAACACCACTGACTCCCTGCCGCGGCTTGCGTCCGAAGGA
ATCATCGGAGGCACTGAAACCATCCGGGCGAGCATCGTGCTCCCCATGAA
ATGCCAGCTGAGCAAACCGACGGACATCAAGGTGCGCGAATTTAGTGGCA
CGCTGCACATGAGCGGCATTATTACCTCAAAGGTATTCTGCAATCCTCGA
AACAGTATAGCAGATGTTAAGCGTTTCCTACGCGACGATGTGCTCCGTTC
GCTGATAACGCGTATACAAGTGTACTGCGATGGACTCACCGATCCATATG
TGACCAATGAAGCTCTGTACATTAGTGAGCCGCCGAGACGTGTGTTCTTC
AGCCTGCCTTCAGAGGGTCCCAGTGCGTCGGTCGGAGCAGTAGTTCAGTT
TTCCGAGTACTTATTCCGTGGCGAGGCACCAACTGTTGTGGTGGCCCAGG
CTAAACAGATTCTGGACGTGGATCTAGATCCAGAGACCATATCCGTGGAG
GCAGAGGGACTCCCGGATGATACGCACTTCAACAATTGCAAGATGGACGC
TGATTGCATAGACGATTCTGGGATTATGACCAGTTCGATGCCAAAGCCGG
AACTTTCGCGCAGCCTTTACATGGTGGGAATCGCAGTGGCCCTGCTGGTC
CTCCTGTCCTCCGTGGCACTTCACTTTGTCCTAGCCGAGCGGGCAAGCTT
TCTAGACCAT

BO27192.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG10616-RC 1479 CG10616-PC 1..1476 17..1492 7380 100 Plus
CG10616-RA 1479 CG10616-PA 1..1476 17..1492 7380 100 Plus
CG10616-RB 1527 CG10616-PB 534..1524 502..1492 4955 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG10616-RC 1838 CG10616-RC 110..1585 17..1492 7380 100 Plus
CG10616-RA 1689 CG10616-RA 110..1585 17..1492 7380 100 Plus
CG10616-RB 1737 CG10616-RB 643..1633 502..1492 4955 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12473185..12474175 502..1492 4955 100 Plus
3L 28110227 3L 12472022..12472197 110..285 880 100 Plus
3L 28110227 3L 12472707..12472832 376..501 630 100 Plus
3L 28110227 3L 12471837..12471929 17..109 465 100 Plus
3L 28110227 3L 12472546..12472637 284..375 460 100 Plus
Blast to na_te.dros performed on 2014-11-28 07:50:18 has no hits.

BO27192.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-22 09:24:30 Download gff for BO27192.complete
Subject Subject Range Query Range Percent Splice Strand
CG10616-RA 77..1552 17..1494 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:35 Download gff for BO27192.complete
Subject Subject Range Query Range Percent Splice Strand
CG10616-RA 110..1585 17..1494 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:04:56 Download gff for BO27192.complete
Subject Subject Range Query Range Percent Splice Strand
CG10616-RA 110..1585 17..1494 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:04:56 Download gff for BO27192.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12473185..12474175 502..1494 99   Plus
3L 12472707..12472832 376..501 100 -> Plus
3L 12472547..12472637 285..375 100 -> Plus
3L 12472022..12472196 110..284 100 -> Plus
3L 12471837..12471929 17..109 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:35 Download gff for BO27192.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12466285..12467275 502..1494 99   Plus
arm_3L 12465807..12465932 376..501 100 -> Plus
arm_3L 12465647..12465737 285..375 100 -> Plus
arm_3L 12465122..12465296 110..284 100 -> Plus
arm_3L 12464937..12465029 17..109 100 -> Plus

BO27192.pep Sequence

Translation from 16 to 1510

> BO27192.pep
MRTVLLSKHDELYLEKCAQENQFSYGIIVGHQADLTKSVVVHLARNNEED
ADLEDLSEVRLTISDINSQALASQWLSASKMCPGSFDVIGIFVSSVRSDV
VNEQSAEFKNAKKLFSDIYDLLLKSNSSFGVYTTDIAQTDFVFLSYSLAD
KKVLCKNYSYGNGGTFTNMEFRFVDKPFEWIQLECSYDFDDVLPILDSSR
RVNIEDQFQSMIVSVRKNLLASEVFLQNEVVEDTIDLQAYIKKKKTKVDK
LQPTSTTGGTATASSNTTDSLPRLASEGIIGGTETIRASIVLPMKCQLSK
PTDIKVREFSGTLHMSGIITSKVFCNPRNSIADVKRFLRDDVLRSLITRI
QVYCDGLTDPYVTNEALYISEPPRRVFFSLPSEGPSASVGAVVQFSEYLF
RGEAPTVVVAQAKQILDVDLDPETISVEAEGLPDDTHFNNCKMDADCIDD
SGIMTSSMPKPELSRSLYMVGIAVALLVLLSSVALHFVLAERASFLDH

BO27192.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG10616-PC 492 CG10616-PC 1..492 1..492 2487 100 Plus
CG10616-PA 492 CG10616-PA 1..492 1..492 2487 100 Plus
CG10616-PB 508 CG10616-PB 1..508 1..492 2454 96.7 Plus