Clone BO27201 Report

Search the DGRC for BO27201

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:272
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG11670-RD
Protein status:BO27201.pep: Imported from assembly
Sequenced Size:1246

Clone Sequence Records

BO27201.complete Sequence

1246 bp assembled on 2010-09-17

GenBank Submission: KX798652

> BO27201.complete
GAAGTTATCAGTCGACATGGCGGATTGGAAGAGACCTTTGGAGACCTGCA
TCGCACTCTGTGTGCTCCTGTGCGTATTTCACGTGAACGGACAGTGGGAG
TTTCCCGCCCAGTATCCGGAACCGTATCGAAATCCGAATCCGAATCCAGT
GCCGGATCCAACCAGACCGCCGCCGCCACCACCTTCTCCGCCATGTGGAA
GACCACCGCCTGGATCTCCGCCACCGGGCCCGCCTCCACCTGGTCCTCCA
CCTGGTTGCCCCGGAGGTCCAGGAGGTCCGCTGCAGCATCGGCAATGGGA
CAATGGCCCCAGGCAGTGGCAACCACGTCGTCCGCCACCAAATCACCATC
GCAACTTCCACAACATCTTCCTGAACACCGAAAGCAAAGTGGACGGGGAG
AACTACAACAAGACCGCGGAGACGGAGGACTTGCACGACGACTTCAATGG
CCGATCCATTGTGGCACCTGGACAGTACCCGCACATGGCCGCTCTGGGAT
TCCGGAACGAGAACCACGAGATCGACTACAAATGTGGTGGAAGCCTCATC
AGCGAAGAGTTCGTGCTCACAGCTGCTCATTGCCTGACTACTCATGGCAC
CTCGCCCGACATCGTAAAAATCGGAGACATTAAGCTCAAGGAATGGGAGC
TCAACGTGGCGCCCCAAAGACGACGTGTTGCCCAGATCTATCTGCATCCA
CTGTACAATGCGAGTCTTAACTACCATGACATCGGGCTCATCCAGCTGAA
TCGACCGGTGGAATACACCTGGTTCGTGAGGCCAGTTCGCCTGTGGCCCA
TGAACGACATACCATACGGCAAGCTGCACACCATGGGCTATGGCTCGACG
GGATTCGCCCAGCCGCAGACGAACATACTCACGGAACTGGATCTCTCGGT
GGTGCCCATTGAGCAGTGTAACTCCAGTCTGCCAGCCGACGAAGGTTCTC
CCCACGGATTACTCACAAGTCAGATATGCGCCCATGACTATGAGAAAAAT
CGCGATACTTGCCAGGGCGATTCTGGAGGACCGCTTCAACTGAACTTGGA
ACGTCGGCGTCGAAGGCACACAAGTCGTAAACACTATCGCTACTACCTGG
TGGGCATCACATCGTATGGAGCATATTGTCGCAGTGAACTTCCAGGTGTT
TATACGCGTGTTTCATCCTATATCGATTGGATAGCATCCATAGTGTGGCC
TAATTATTATAGCGAATTTACTAATCAAGCAAGCTTTCTAGACCAT

BO27201.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11670-RD 1215 CG11670-PD 1..1212 17..1228 6060 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG11670-RD 1337 CG11670-RD 43..1254 17..1228 6060 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13043250..13043669 597..1016 2100 100 Plus
3R 32079331 3R 13042320..13042644 164..488 1625 100 Plus
3R 32079331 3R 13042092..13042240 17..165 745 100 Plus
3R 32079331 3R 13043720..13043853 1014..1147 670 100 Plus
3R 32079331 3R 13042884..13042994 487..597 555 100 Plus
3R 32079331 3R 13043918..13044003 1143..1228 430 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:41:51 has no hits.

BO27201.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-17 10:26:31 Download gff for BO27201.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RD 25..1236 17..1230 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:27:25 Download gff for BO27201.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RD 43..1254 17..1230 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:16:27 Download gff for BO27201.complete
Subject Subject Range Query Range Percent Splice Strand
CG11670-RD 43..1254 17..1230 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:16:27 Download gff for BO27201.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13043921..13044003 1146..1230 97   Plus
3R 13043722..13043851 1016..1145 100 -> Plus
3R 13043251..13043668 598..1015 100 -> Plus
3R 13042885..13042994 488..597 100 -> Plus
3R 13042322..13042643 166..487 100 -> Plus
3R 13042092..13042240 17..165 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:27:25 Download gff for BO27201.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8869643..8869725 1146..1230 97   Plus
arm_3R 8869444..8869573 1016..1145 100 -> Plus
arm_3R 8868973..8869390 598..1015 100 -> Plus
arm_3R 8868607..8868716 488..597 100 -> Plus
arm_3R 8868044..8868365 166..487 100 -> Plus
arm_3R 8867814..8867962 17..165 100 -> Plus

BO27201.pep Sequence

Translation from 16 to 1246

> BO27201.pep
MADWKRPLETCIALCVLLCVFHVNGQWEFPAQYPEPYRNPNPNPVPDPTR
PPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGPLQHRQWDNGPRQ
WQPRRPPPNHHRNFHNIFLNTESKVDGENYNKTAETEDLHDDFNGRSIVA
PGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIV
KIGDIKLKEWELNVAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEY
TWFVRPVRLWPMNDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQ
CNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRR
HTSRKHYRYYLVGITSYGAYCRSELPGVYTRVSSYIDWIASIVWPNYYSE
FTNQASFLDH

BO27201.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG11670-PD 404 CG11670-PD 1..404 1..404 2296 100 Plus
CG14642-PC 392 CG14642-PC 76..391 45..394 777 47 Plus
CG14642-PB 392 CG14642-PB 76..391 45..394 777 47 Plus
snk-PB 435 CG7996-PB 195..435 152..397 452 38.7 Plus
snk-PA 435 CG7996-PA 195..435 152..397 452 38.7 Plus