Clone BO27210 Report

Search the DGRC for BO27210

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:272
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptAxs-RB
Protein status:BO27210.pep: Imported from assembly
Sequenced Size:799

Clone Sequence Records

BO27210.complete Sequence

799 bp assembled on 2010-09-17

GenBank Submission: KX795802

> BO27210.complete
GAAGTTATCAGTCGACATGTCCGAAGATGCCAAGAGTCCAGGACCACGCA
CACGGAACATCATCGAGAATCAGCTGTTCCGCCGGCAGCGTAGCCTAAAA
TTGGAGGCACTGCAGCGCCAGCGGACCTTGGATTCCAACGATGGGGTGGA
GGGATTGGGCGCAGATACGGAACCCTTCGACAAGACGCACATCGTCATCA
TCTTTACGGAGAAGGCCAAGCTAAGACACTGTCAGGATGTGGAGAAGATC
ATTCAGGAGTTTGGCATCCAGACCACGCTGGAGATCGTAGGGAAAACCGA
AAAGTATCTCTACCTATCGGCCAGCGTGGATACTCTGCTCCGTTTGGCCG
ATGCCGCCGAGCTGGAGAAGATGACCACCACGCACAGCATGCAAAAGTTC
AATCACGGCTGCATCTCGGACTTTCTACTGCCCGGGATGGGCAAAGAGCA
GATCCTGCGCTACTGCGAGATACCTGTTCTCATCAAGGACGTAATCCAGG
ACGGCATTAAGTCCTACGTGCAAAAGGGCTACATAGAGGATATGTTTCCC
CTCCACGATATCCTGTATCTCGAACGCTTCAACTGGAACCTGAAACGCAC
CAAGCTGCCCATCGAGGACATCCGGAACTACTTTGGTTCCAGTATAGGTC
TTTATTTCGGCTTCATCGAGTTCTACACGAAGGCACTGATCTTTCCCTCC
CTTTTTGGTATACTCCAATATGTATTCGATCTGAACATCTCGCTGGTCTG
CAGTTTCTACGTTGTTTGGACCACGGTGAGTGCAAGCTTTCTAGACCAT

BO27210.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Axs-RA 1941 CG9703-PA 1..759 17..775 3795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Axs-RA 2575 CG9703-RA 456..1214 17..775 3795 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16682201..16682472 562..291 1360 100 Minus
X 23542271 X 16681904..16682122 781..563 1095 100 Minus
X 23542271 X 16683209..16683357 184..36 745 100 Minus
X 23542271 X 16683026..16683135 292..183 550 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:43:30 has no hits.

BO27210.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-17 10:26:33 Download gff for BO27210.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RB 456..1220 17..783 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:27:33 Download gff for BO27210.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RA 456..1214 17..775 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:17:00 Download gff for BO27210.complete
Subject Subject Range Query Range Percent Splice Strand
Axs-RA 456..1214 17..775 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:17:00 Download gff for BO27210.complete
Subject Subject Range Query Range Percent Splice Strand
X 16683422..16683440 17..35 100   Minus
X 16683209..16683357 36..184 100 <- Minus
X 16683027..16683133 185..291 100 <- Minus
X 16682201..16682471 292..562 100 <- Minus
X 16681902..16682122 563..783 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:27:33 Download gff for BO27210.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16577455..16577473 17..35 100   Minus
arm_X 16577242..16577390 36..184 100 <- Minus
arm_X 16577060..16577166 185..291 100 <- Minus
arm_X 16576234..16576504 292..562 100 <- Minus
arm_X 16575935..16576155 563..783 99 <- Minus

BO27210.pep Sequence

Translation from 16 to 799

> BO27210.pep
MSEDAKSPGPRTRNIIENQLFRRQRSLKLEALQRQRTLDSNDGVEGLGAD
TEPFDKTHIVIIFTEKAKLRHCQDVEKIIQEFGIQTTLEIVGKTEKYLYL
SASVDTLLRLADAAELEKMTTTHSMQKFNHGCISDFLLPGMGKEQILRYC
EIPVLIKDVIQDGIKSYVQKGYIEDMFPLHDILYLERFNWNLKRTKLPIE
DIRNYFGSSIGLYFGFIEFYTKALIFPSLFGILQYVFDLNISLVCSFYVV
WTTVSASFLDH

BO27210.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
Axs-PA 646 CG9703-PA 1..254 1..254 1315 99.6 Plus