Clone BO27212 Report

Search the DGRC for BO27212

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:272
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptFbp1-RA
Protein status:BO27212.pep: Imported from assembly
Sequenced Size:3121

Clone Sequence Records

BO27212.complete Sequence

3121 bp assembled on 2010-10-15

GenBank Submission: KX798267

> BO27212.complete
GAAGTTATCAGTCGACATGAACAGAATCATGCTGTTGGTGGCCTTTGCGG
CCGGCGTTGTGGCTGCTGGAAGGATAACTACGAATCAGGACAGGGTCCAG
GGTATTGACCGCATGTCCTTGGAGGATCTGCAGCTCCAAAAGTTTATCCT
GGATATCGTCCAGAATATTCGTCAGCCTCTACAGCAGAGTGAGCTCATCA
ATCTAGATGTGGGTCTGATTGCAGACAGTCAGCGTTATCGTGGCGGCATT
GATAAGGTGATGCATAACGTCATCGATCTGGATCGCCAGCGTCGCCTCCT
CGACGAGCACCAGGTGTACTCCGTGGGTCGTTTGGAGCATGTGCAGCAGC
TGCGTGGCATATACCGCCTGCTGGCTCGCGCCCAGGACTTTGACACCCTT
CGCCGTAATGTGGTCTACCTGCGCCGTAACATTAACCCTGTCCTGCTGGT
TAATGCCTTGGCTCTGGCCATTCGCGATCGTGAGGACACTCAAGCTCTGA
TCGTGCCCGCTGTCCAGGAGCTGCTCCCCGAACTGTATCTGGATGAGGAA
GTGATTCAGCAGGTGCGCAGCGTCCTAAGGGAACAAACCCAGCGCCCATC
GCTCATGGACATCGTGGGTATGCGCCAGCGGGCTATGAACCCAGTGATGA
GCATCCTGATGCCCTGGAGGGAGATCCACATGCAGATGGCTCTAAGGAAA
CAGCAGAACATCCAGAACGTTTTGGGCCAGAAACGCGTCGTTGTCCGTGC
CGAGAACCAGGGACAGGTTGAGGGCACCTCTCTGCTGACGGACGATATTG
AGTTGCAGAACTTTGTTCAAAATCTCATACAGGAACTTGCCCTTCTGGAG
GATGTTACTCAGTTGGAGCAGAGCCAATTGATCAACAATGATCAACGTGA
AGAGCAATGGGTCGGTCGTCAGCGCGTGCAGTACCAAGATAACAACCAGG
AAAGAGATCTGGGTCAGGATGTAGACACTGGACGCCTACTCCGTGTGAGT
CGCCGCCGCCTTCTGGAGCAACAGGATGAATATCAGGGTCAGAACATCTA
TGGAAACCAAAAGGATCGTTTCCAGCGTCTCCTCCGCCGGGATGACGACA
ACGACGACAATGATGACGATGATGATCAGGATATTCGCATGGGTCGTGTC
CAGCTGCAGCGTGGTATCAGCCAGGGAGGTCTCCGCATTGGAGGAGCTCA
TAACCTGCCCACCGTTAGCGTGAACAGTGACCGTCTGCTTCACGTGAGCC
GTCGCCGTTTGAACGCCATCCAACAAGATCAGCAGCAGGATCAGCTGAAC
GGTCGCCAGCGTTTCATGGGTTTGGTGAGAGGAGACCGCCTCAGTGAGGG
TCGTCGTGTTGGTCAGCTGGATGATGTGCGTCAGGAGCGTCAGAACAACT
GGCAGAAGCAGGACTACATCTTGACACAAGGTCGCACTTTCGGAGTCCAG
CAGGAGCGTCAAAACTATGCCGATCAGTTGGAGAGCGTGAGCCGCGACGA
CGAGCGATTGGTGCATATTAACCGACGCCGCCTCAACCAGGACAACCAGG
ACATCCAGCAACAACAGATGCATTTTCCCCGCAGGATTAACTCCATTGGC
GAGGGTCGCCGCGTCATGGGTGAGCGCCCCATCCAAGATGAGGACATTCT
GAAGCTAATCCGCGGCGAAAACCGTCTGAAGCTGATGACCGATGATGAGA
TCCTTGAGATGCTGCAAAGGAACCGCCAGCAGCGTCTGCAAAAGCACCAG
AACGATGATGATGACGATGTCAACGATGACGATGTGAATGTGGTGCACCG
ACAGGGACTACGAAGCCGCCGCAGCCTTCCCAATCTCCGTCAGCAAAACA
ACCGCCTCAGCGAAATTGTCCTGCACAATCTTCGCCAGCTGGTCGCACGT
CTTAACCAGGAAAGCATCGCCCAGGGACAGCTGATCGAAGAGCAGCAGCA
GTTGATCAACAATCCCCGCCTGACGCAATCCGAGCGATATGCCCTCCGCT
TGAACCAAATCCGAATCAATTCCCAGCGCAGCCGTCAAGTCCTCGCCCAG
ATCGGCCAGATTGAGCAGCGTATCCAGGAGGTTATTGGTCAGGTGCTGAA
CCAGGTGAATGTCAACTCGCTGCGTGGCCAGGTAATCGATCAACGCCAAG
TGGAATCCCTGATCGCCGATGTACTGCTGGGTCGCCTTGGTCAGGTTGGC
ATCATGACCATTATCCGCCAGGTGGTCCAGGACAACAACATTGAGCAAAT
CGATCGTACTGGCTTGGGCATCCGCCTCAGCGATCCCGTCGTGCAGTACA
CCCTGCGCCGGATTGTGAGGATCGTGGACGAACAGCGTGAACAAATCCTT
GGAGGCTACCGCCAGGAGCAACTGCAGATGCGCGGTGTTTCGATCAACGA
TGTTCGTGTGGATAAACTGCGCACTCGCATCGAGGAGCACGAATTGGACC
TGAGCAACTTGGTCGAGCAGCAGGTTCAGGGCATCCAGCAGGAGATTGTG
GGACGCCAGCGTCGCCTCAACAACAAGGCCTTCACCATTGACATGGACAT
CACTTCGGATCAGGATCAGGATGCTATTATTCGCATCTTCCTGGGACCCG
CAGAGGATCAACAGGGAAGGCAAGGAGCTTCCCTGGATGAGCGCCGACGT
GACTTCGTTCTTCTCGATGCCATCCAAGTGCAGCTGGAGAATGGACGCAA
CCGCATTCATCGCAGGTCCATCGATATCCCCTGGACAACTAGCGATGTGA
CGCCCCTGGTGGAGATCTACCGCCAAGTGATGCTGCAATTGAAGGGTCAG
CAGGCGCAACAGGTCGTGGGTATCCAACAGCTGGTCGGCGAGAACGGACG
CTTCCCCCAGCACTTGCTGCTACCCCGTGGAAGGCCCGAGGGTCTCCCCA
TGCAACTCCTGGTCGTGGTTTCTCCTCTGGTTGAGCTGCAGGTTCAGGAC
GTCGTTCCCGCTATCACCATTGGCATTGGCTCCGCCTCTCTTCGTGATGC
CCGCCCATTGGGTTATCCTCTGGACCGGCCCATCCATAACGAGCAGGAGC
TCCTGCAGTTGACCAATGTCCTGCTTCAGGATGTGGTCATCATTCAGGAG
AACGCAAGCTTTCTAGACCAT

BO27212.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp1-RA 3090 CG17285-PA 1..3087 17..3103 15435 100 Plus
Fbp1-RD 3084 CG17285-PD 1..3081 17..3103 15310 99.8 Plus
Fbp1-RB 2994 CG17285-PB 1..2991 113..3103 14955 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp1-RA 3405 CG17285-RA 95..3181 17..3103 15435 100 Plus
Fbp1-RD 3399 CG17285-RD 95..3175 17..3103 15310 99.8 Plus
Fbp1-RB 3465 CG17285-RB 245..3241 107..3103 14985 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14094813..14097809 3103..107 14985 100 Minus
3L 28110227 3L 14097869..14097959 107..17 455 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:06:45 has no hits.

BO27212.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:14 Download gff for BO27212.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 98..3184 17..3105 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:05 Download gff for BO27212.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 95..3181 17..3105 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:43 Download gff for BO27212.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 95..3181 17..3105 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:43 Download gff for BO27212.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14097869..14097959 17..107 100   Minus
3L 14094811..14097808 108..3105 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:05 Download gff for BO27212.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14090969..14091059 17..107 100   Minus
arm_3L 14087911..14090908 108..3105 99 <- Minus

BO27212.pep Sequence

Translation from 16 to 3121

> BO27212.pep
MNRIMLLVAFAAGVVAAGRITTNQDRVQGIDRMSLEDLQLQKFILDIVQN
IRQPLQQSELINLDVGLIADSQRYRGGIDKVMHNVIDLDRQRRLLDEHQV
YSVGRLEHVQQLRGIYRLLARAQDFDTLRRNVVYLRRNINPVLLVNALAL
AIRDREDTQALIVPAVQELLPELYLDEEVIQQVRSVLREQTQRPSLMDIV
GMRQRAMNPVMSILMPWREIHMQMALRKQQNIQNVLGQKRVVVRAENQGQ
VEGTSLLTDDIELQNFVQNLIQELALLEDVTQLEQSQLINNDQREEQWVG
RQRVQYQDNNQERDLGQDVDTGRLLRVSRRRLLEQQDEYQGQNIYGNQKD
RFQRLLRRDDDNDDNDDDDDQDIRMGRVQLQRGISQGGLRIGGAHNLPTV
SVNSDRLLHVSRRRLNAIQQDQQQDQLNGRQRFMGLVRGDRLSEGRRVGQ
LDDVRQERQNNWQKQDYILTQGRTFGVQQERQNYADQLESVSRDDERLVH
INRRRLNQDNQDIQQQQMHFPRRINSIGEGRRVMGERPIQDEDILKLIRG
ENRLKLMTDDEILEMLQRNRQQRLQKHQNDDDDDVNDDDVNVVHRQGLRS
RRSLPNLRQQNNRLSEIVLHNLRQLVARLNQESIAQGQLIEEQQQLINNP
RLTQSERYALRLNQIRINSQRSRQVLAQIGQIEQRIQEVIGQVLNQVNVN
SLRGQVIDQRQVESLIADVLLGRLGQVGIMTIIRQVVQDNNIEQIDRTGL
GIRLSDPVVQYTLRRIVRIVDEQREQILGGYRQEQLQMRGVSINDVRVDK
LRTRIEEHELDLSNLVEQQVQGIQQEIVGRQRRLNNKAFTIDMDITSDQD
QDAIIRIFLGPAEDQQGRQGASLDERRRDFVLLDAIQVQLENGRNRIHRR
SIDIPWTTSDVTPLVEIYRQVMLQLKGQQAQQVVGIQQLVGENGRFPQHL
LLPRGRPEGLPMQLLVVVSPLVELQVQDVVPAITIGIGSASLRDARPLGY
PLDRPIHNEQELLQLTNVLLQDVVIIQENASFLDH

BO27212.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp1-PA 1029 CG17285-PA 1..1029 1..1029 5153 100 Plus
Fbp1-PD 1027 CG17285-PD 1..1027 1..1029 5130 99.8 Plus
Fbp1-PB 997 CG17285-PB 1..997 33..1029 4999 100 Plus
Lsp1alpha-PA 816 CG2559-PA 346..780 610..1025 358 28.1 Plus
Lsp1gamma-PA 772 CG6821-PA 315..729 612..1006 333 28 Plus
Lsp1alpha-PA 816 CG2559-PA 33..192 38..198 192 26.1 Plus