Clone BO27234 Report

Search the DGRC for BO27234

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:272
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptCG5028-RC
Protein status:BO27234.pep: Imported from assembly
Sequenced Size:1210

Clone Sequence Records

BO27234.complete Sequence

1210 bp assembled on 2010-09-17

GenBank Submission: KX794001

> BO27234.complete
GAAGTTATCAGTCGACATGGCCCTTCGCTTGACCCAGAGATTGCTGCAGA
CGCAGACGCCGTTCCTCACTCGCGGCTATCCCTTGCTGGTGACCAAGGAG
AAGACCGAGGATGTGGCCCACACCAAATCGGCGCTGCAGAAGAAAGTCAC
GGGCACCGATATTCCCTCGGCACAGTACGGAGGTCGTCATGCCGTCACCA
TGCTGCCGGGCGGCGGCATTGGTCCTGAACTGATGGGCTATGTGCGCGAG
ATCTTCCGGTATTGCGGTGCACCCATCGATTTCGAGGTGATCGACATCGA
TCCCTCCACCGAGGGCAACGATGATCTGGACTATGCCATCACATCGATTA
AGAGGAACGGAGTGGCACTCAAGGGCAACATCGAGACCAAGTCCCAATCC
TTGACCGAAGTCTCCCGCAACGTGGCCATCCGTAACGAGCTGGATCTGTA
CGTCAATGTGGTGCACTGCAAGTCGTATCCGGGCATTCCGGCCCGCCATC
ACGACATTGACGTGGTGCTCATCCGCCAAAACACCGATGGCGAGTACGCC
ATGTTGGAACATGAGTCTGTGCCCGGAATTGTGGAGAGCATGAAAGTGGT
GACCGTCGAGAATGCCGAGCGTGTGGCCCGCTACGCCTTTGAGTTCGCCC
GCCAAAACAATCGCAAGAAGGTTACCACCATTCACAAGGCCAACATCATG
AAGCTGTCCGATGGTCTCTTCCTGGAGGTTGCCAACCGTGTGCACAAGGA
CTATCCCGAACTGGAGCACAACAACATGATTATCGACAACACCTGCATGC
AGTCCGTGTCGAATCCTCACCAGTTCGACGTGATGAACATGACCAATCTG
TACGGCACCATCGTGTCCAATGTTCTTTGCGGTTTGATGGGCGGAGCTGG
CCTCATATCCGGCAGGAACTACGGTGACCATTACGCCATCTTTGAGCCTG
GCACCCGTAACACCGGAACCGCCATTGCCGGCAAGAATATCGCCAACCCT
GTGGCCATGATCAGTGCCAGTATCGATATGTTGAACCATCTGGGCCACAA
GGAGCACGCCAATGTCATTCAGGAGGCCGTCTACCAGACCATTGTCAACG
ATGCCATTCGCACGCCAGATATTGGCGGCACCAACTCCAGTACCGATGTG
GTTGAGAATATACTCAAGATCTTGAGTGCCAAGCGCGTGAATGCAAGCTT
TCTAGACCAT

BO27234.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-RD 1182 CG5028-PD 1..1176 17..1192 5880 100 Plus
CG5028-RC 1179 CG5028-PC 1..1176 17..1192 5880 100 Plus
CG5028-RB 1209 CG5028-PB 1..1176 17..1192 5880 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-RD 1742 CG5028-RD 122..1298 16..1192 5885 100 Plus
CG5028-RC 1608 CG5028-RC 122..1298 16..1192 5885 100 Plus
CG5028-RB 1934 CG5028-RB 122..1298 16..1192 5885 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25681265..25682045 151..931 3905 100 Plus
3R 32079331 3R 25682105..25682291 932..1118 935 100 Plus
3R 32079331 3R 25681121..25681199 74..152 395 100 Plus
3R 32079331 3R 25682353..25682429 1116..1192 385 100 Plus
3R 32079331 3R 25680966..25681024 16..74 295 100 Plus
Blast to na_te.dros performed on 2014-11-28 07:37:13 has no hits.

BO27234.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-20 11:04:58 Download gff for BO27234.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RC 150..1325 17..1194 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:28:31 Download gff for BO27234.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RB 123..1298 17..1194 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:00:21 Download gff for BO27234.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RB 123..1298 17..1194 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:00:21 Download gff for BO27234.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25682356..25682429 1119..1194 97   Plus
3R 25682105..25682291 932..1118 100 -> Plus
3R 25681266..25682045 152..931 100 -> Plus
3R 25681121..25681198 74..151 100 -> Plus
3R 25680967..25681023 17..73 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:28:31 Download gff for BO27234.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21508078..21508151 1119..1194 97   Plus
arm_3R 21507827..21508013 932..1118 100 -> Plus
arm_3R 21506988..21507767 152..931 100 -> Plus
arm_3R 21506843..21506920 74..151 100 -> Plus
arm_3R 21506689..21506745 17..73 100 -> Plus

BO27234.pep Sequence

Translation from 16 to 1210

> BO27234.pep
MALRLTQRLLQTQTPFLTRGYPLLVTKEKTEDVAHTKSALQKKVTGTDIP
SAQYGGRHAVTMLPGGGIGPELMGYVREIFRYCGAPIDFEVIDIDPSTEG
NDDLDYAITSIKRNGVALKGNIETKSQSLTEVSRNVAIRNELDLYVNVVH
CKSYPGIPARHHDIDVVLIRQNTDGEYAMLEHESVPGIVESMKVVTVENA
ERVARYAFEFARQNNRKKVTTIHKANIMKLSDGLFLEVANRVHKDYPELE
HNNMIIDNTCMQSVSNPHQFDVMNMTNLYGTIVSNVLCGLMGGAGLISGR
NYGDHYAIFEPGTRNTGTAIAGKNIANPVAMISASIDMLNHLGHKEHANV
IQEAVYQTIVNDAIRTPDIGGTNSSTDVVENILKILSAKRVNASFLDH

BO27234.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-PC 392 CG5028-PC 1..392 1..392 2022 100 Plus
CG5028-PD 393 CG5028-PD 1..392 1..392 2022 100 Plus
CG5028-PB 402 CG5028-PB 1..392 1..392 2022 100 Plus
CG5028-PA 402 CG5028-PA 1..392 1..392 2022 100 Plus
CG6439-PB 370 CG6439-PB 22..370 35..387 791 43.7 Plus