Clone BO27321 Report

Search the DGRC for BO27321

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptTdc2-RA
Protein status:BO27321.pep: Imported from assembly
Sequenced Size:1945

Clone Sequence Records

BO27321.complete Sequence

1945 bp assembled on 2010-09-13

GenBank Submission: KX797867

> BO27321.complete
GAAGTTATCAGTCGACATGGACAGCACCGAATTTCGAAAACGTGGCATGG
AAATGGTGGAGTACATCTGCAACTATCTGGAAACGCTGAACGAGCGACGG
GTCACGCCCAGCGTGGAGCCGGGATATTTGAGACACCTGTTGCCACCTGA
GGCACCGCAGGAGCCGGAGGACTGGGACCAGATCATGAGGGACGTGGAGG
ACAAGATCATGCCCGGCGTGACGCATTGGCAGCATCCTCGCTTCCACGCC
TATTTTCCGGCGGGCAACTCGTTCCCCTCTATCCTGGGCGACATGTTGGG
CGACGGGATCGGGTGCATCGGCTTCTCCTGGGCCGCCAGTCCCGCGTGCA
CCGAGCTGGAGACCATAGTGCTCGACTGGCTTGGCAAGGCCATCGGTCTG
CCGGACCACTTTCTGGCCCTCAAGGAGGGCAGCACCGGAGGGGGAGTCAT
CCAGACTTCCGCATCGGAGTGCGTACTGGTCACGATGCTTGCTGCCAGGG
CACAGGCGCTCAAGAGGCTCAAGGCCCAGCACCCGTTTGTGGAGGAGGGT
CACCTGCTGTCCAAGCTTATGGCCTACTGCTCCAAGGAGGCGCACAGCTG
CGTGGAGAAAGCGGCGATGATCTGTTTCGTGAAGCTGCGCATTCTGGAGC
CCGACGACGACGCCAGTCTGCGCGGCCAGACGATCTACGAGGCAATGGAG
GAGGACGAACTGCAGGGTCTGGTGCCCTTCTTCGTCTCCACCACTCTGGG
TACCACGGGCTCGTGTGCGTTCGACAATCTGCCAGAGATCGGCAAGCAGT
TGCAGCGATTCCCGGGCGTTTGGCTGCACGTGGATGCCGCCTACGCGGGC
AACAGCTTCATCTGCCCCGAGCTGAAGCCGCTCCTGAAGGGCATCGAGTA
CGCCGACTCGTTCAACACCAATCCCAACAAATGGCTGCTGACGAACTTCG
ATTGCTCGACGCTGTGGGTGCGGGACCGCATCCGGCTGACTTCAGCCCTG
GTGGTGGATCCGCTGTACCTGAAGCACGGCTACTCGGATGCGGCCATCGA
CTATCGTCATTGGGGAGTTCCACTCAGTCGGCGTTTTCGTTCGCTGAAGC
TGTGGTTCGTGCTGCGATCCTATGGGATTTCCGGGCTGCAGCATTATATA
CGTCACCATATCAAGCTGGCCAAGCGGTTCGAAGAGCTCGTGCTCAAAGA
TAAGCGCTTCGAGATCTGTAACCAAGTCAAGCTGGGCCTGGTCTGCTTTC
GGCTGAAGGGTTCCGACAAGCTGAATGAGAAGCTGCTGAGCATAATCAAC
GAGTCCGGCAAGCTGCACATGGTTCCGGCCAGCGTGGGCGATCGCTACAT
CATCAGGTTCTGCGCCGTGGCCCAAAACGCGACCGCTGAGGACATTGACT
ACGCCTGGGACATCATCGTGGACTTTGCCAACGAGTTGCTGGAGAAGGAG
CAGCACGATGAGCTGTCCGAGATCATGAACCGCAAGAAGCAGGACACGCT
GGCCCAGAAGCGCTCATTCTTCGTGCGCATGGTCAGCGATCCGAAGATCT
ACAACCCGGCGATCAACAAGGCCGGCACTCCCAAGCTCTCAATGGAGCTG
CCCTCGCCCGTTGTGAGCCGCGGCAGTGCCCCCATTATCCGGACCCAGAG
TTCGGTGGACCACAACTCGTGGATATCCTGGCCGCTGGCATTCCTCTTCA
ACAGCAACAACGAGGAAAAGGGCAGTAACGTCTCGTTGCGTTTCCGACAC
CTGGACACCAACGTACGACCATCGTCGTCGCGACGAAACTCCGGAGCCGG
CTCGTCACCCTCTCCGGAAAACGAGTTGGACTACGTGAACGTCCAGCAGC
AGCAGATGGAACAGCGATCGCCACGACGATCGCCCATGGCGGTGCGCAAG
GCATCGTCCACGCGGGACAACCTCAACGCAAGCTTTCTAGACCAT

BO27321.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Tdc2-RA 1914 CG30446-PA 1..1911 17..1927 9555 100 Plus
Tdc1-RA 1764 CG30445-PA 875..956 894..975 230 85.4 Plus
Hdc-RD 2544 CG3454-PD 229..389 245..405 205 75.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
Tdc2-RA 2303 CG30446-RA 163..2073 17..1927 9555 100 Plus
Tdc1-RA 2281 CG30445-RA 1087..1168 894..975 230 85.4 Plus
Hdc-RD 3733 CG3454-RD 920..1080 245..405 205 75.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6685271..6685781 1740..1230 2555 100 Minus
2R 25286936 2R 6687407..6687846 890..451 2200 100 Minus
2R 25286936 2R 6688003..6688310 454..147 1540 100 Minus
2R 25286936 2R 6687137..6687355 1106..888 1095 100 Minus
2R 25286936 2R 6684975..6685162 1927..1740 940 100 Minus
2R 25286936 2R 6688373..6688502 146..17 650 100 Minus
2R 25286936 2R 6686660..6686787 1231..1104 640 100 Minus
2R 25286936 2R 6678236..6678317 975..894 230 85.4 Minus
2R 25286936 2R 10241871..10242031 245..405 205 75.2 Plus
Blast to na_te.dros performed on 2014-11-28 08:14:38 has no hits.

BO27321.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:22 Download gff for BO27321.complete
Subject Subject Range Query Range Percent Splice Strand
Tdc2-RA 151..2061 17..1929 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:24 Download gff for BO27321.complete
Subject Subject Range Query Range Percent Splice Strand
Tdc2-RA 163..2073 17..1929 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:13:55 Download gff for BO27321.complete
Subject Subject Range Query Range Percent Splice Strand
Tdc2-RA 163..2073 17..1929 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:13:55 Download gff for BO27321.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6688373..6688502 17..146 100   Minus
2R 6688003..6688310 147..454 100 <- Minus
2R 6687408..6687842 455..889 100 <- Minus
2R 6687139..6687353 890..1104 100 <- Minus
2R 6686660..6686786 1105..1231 100 <- Minus
2R 6685271..6685779 1232..1740 100 <- Minus
2R 6684973..6685161 1741..1929 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:24 Download gff for BO27321.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2575878..2576007 17..146 100   Minus
arm_2R 2575508..2575815 147..454 100 <- Minus
arm_2R 2574913..2575347 455..889 100 <- Minus
arm_2R 2574644..2574858 890..1104 100 <- Minus
arm_2R 2574165..2574291 1105..1231 100 <- Minus
arm_2R 2572776..2573284 1232..1740 100 <- Minus
arm_2R 2572478..2572666 1741..1929 98 <- Minus

BO27321.pep Sequence

Translation from 16 to 1945

> BO27321.pep
MDSTEFRKRGMEMVEYICNYLETLNERRVTPSVEPGYLRHLLPPEAPQEP
EDWDQIMRDVEDKIMPGVTHWQHPRFHAYFPAGNSFPSILGDMLGDGIGC
IGFSWAASPACTELETIVLDWLGKAIGLPDHFLALKEGSTGGGVIQTSAS
ECVLVTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAA
MICFVKLRILEPDDDASLRGQTIYEAMEEDELQGLVPFFVSTTLGTTGSC
AFDNLPEIGKQLQRFPGVWLHVDAAYAGNSFICPELKPLLKGIEYADSFN
TNPNKWLLTNFDCSTLWVRDRIRLTSALVVDPLYLKHGYSDAAIDYRHWG
VPLSRRFRSLKLWFVLRSYGISGLQHYIRHHIKLAKRFEELVLKDKRFEI
CNQVKLGLVCFRLKGSDKLNEKLLSIINESGKLHMVPASVGDRYIIRFCA
VAQNATAEDIDYAWDIIVDFANELLEKEQHDELSEIMNRKKQDTLAQKRS
FFVRMVSDPKIYNPAINKAGTPKLSMELPSPVVSRGSAPIIRTQSSVDHN
SWISWPLAFLFNSNNEEKGSNVSLRFRHLDTNVRPSSSRRNSGAGSSPSP
ENELDYVNVQQQQMEQRSPRRSPMAVRKASSTRDNLNASFLDH

BO27321.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Tdc2-PA 637 CG30446-PA 1..637 1..637 3359 100 Plus
Tdc1-PA 587 CG30445-PA 1..482 1..484 1456 56.8 Plus
Hdc-PC 619 CG3454-PC 1..476 1..477 1407 55.1 Plus
Hdc-PD 847 CG3454-PD 1..476 1..477 1407 55.1 Plus
Hdc-PB 847 CG3454-PB 1..476 1..477 1407 55.1 Plus