Clone BO27328 Report

Search the DGRC for BO27328

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptCG12512-RA
Protein status:BO27328.pep: Imported from assembly
Sequenced Size:1813

Clone Sequence Records

BO27328.complete Sequence

1813 bp assembled on 2010-09-13

GenBank Submission: KX794857

> BO27328.complete
GAAGTTATCAGTCGACATGAACAGCAAGCTGCAGACCATCTCCCGATACA
TGCTCAGGCAGAAATGTGCCTTCAACTCGATGCGCAGCATTTCCACCTCG
ATGCCCAGCTTGATCAGCCATAAGCATCATATTGGTAAGGATCCCTTGGT
ATATCGCACCATTGGCCAGCAGTTGGAGCTATCTGCTTCGAATTTTGGGG
ATGTGGAGGCGATTGTCTCCTGTCACGAGGGCAAGCGGTACAGCTTCAAA
AGTTTGCTACAGGAAGCGGATGCGCTGGCGGCGGGTTTCCGGAAATTGGG
CCTGCAGCCAGGTGATGCCGTTGGTCTGTGGGCACCTAACTACTTGCACT
GGTACTTGGGCATGATGGGAGCAGCTCGAGCGGGTCTCACCTCGGTGGGT
TTGAATCCAGCTTACCAGGGACCCGAAATAGCCTACTGTCTGAATAAGGT
CAATGTGAAGGCCATCATTGCGCCGGAGACCTTCAAGACGCAGAACTACT
ATGAGATTTTGAGAGATATCTGCCCGGAAATCTCAGATGCGGATACTGGC
AAGATCCGGAGTGAGAAGTTTCCGCACCTGCGATCCGTAATCATTGATAG
CAACGATAGCCTGAAGGGTGCCCTGCGCTTCGATGACTTCCTGGACCTGG
CCAGCAAATCGGAGCGCGAAGAGGTGGCCAAAATGCAGAAGAGCATTCTG
CCCGAGTCTGCGTGCAATATTCAGTTCACATCGGGAACCACTGGCAATCC
CAAGGCTGCCTGTCTTACCCATCACAATTTCGTCAACAATGGCATCCATG
TGGGCAATCGCAACGAACTGGAGGGCGAGAGGATCTGTGTTCAGGTGCCC
ATGTTCCATGCCTTCGGTGTGATCATCTCCATCATGGCTGCTCTGACCAA
AGGTGCCACCATGGTCCTACCCGCTGCCGGTTTCAGTCCCAAGGACTCGC
TGCAAGCCATCGTCAATGAAAAGTGTTCGGTGATCCATGGCACACCAACC
ATGTATGTGGATTTGGTCAACACGCAAAAGAAGCTACAGGTGCCGCTGGG
CAGGATTAAGAAGGCCGTCACCGGAGGTGCCATTGTATCGCCGCAGCTGA
TCAAGGATGTGAGACAGGTTCTCAACGTGGAAGCGGTGCATAGTGTCTAT
GGCCTGACGGAAACCACAGCTGTGATCTTCCAATCCTTGCCCGGCGATAG
CAGTGATGTTGTCCTCAACTCAGTTGGCCATCTGACGGATCACATCGAAG
CCAAGGTGGTGGATGCCGAGGGCAGGTGTGTGCCATTTGGACAGCCCGGA
GAGCTGTGCGTCCGCGGATATACCACAATGCTGGGCTACCACGATGATGA
GGAGAAAACAAAGGAAACCATCGGTAATGATAGGTGGTTGCGCACGGGCG
ATCAGTTTGTCCTGGAGGCCAATGGATATGGACGGATTGTGGGTCGCCTA
AAGGAGATGCTCATCCGTGGCGGCGAAAATATATTCCCCAAAGAGATCGA
AGACTTTCTAAACGCCCATCCACAGGTCATTGAGGCGCATGTGATTGGAG
TGCCTGATGAGCGATTGGGTGAAGAAGTCTGCGCCTATGTTCGCCTGGAG
GAGGGCGTGGACCCCGCCTCCTTCACCGCGGAGACCTTAAAGGCCTATGC
CAAGGGCAAGCTGGCCCACTTCAAGGTGCCCAGATATGTGATCCCCATAG
ATGCATTCCCTAAAACCACCTCGGGCAAGATCCAGAAATTCAAGCTAGTG
GAGGCTTTCAAGGCCAAGGAAACAGAGCTAAAAGCTGCCAGACTAGCAAG
CTTTCTAGACCAT

BO27328.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG12512-RA 1782 CG12512-PA 1..1779 17..1795 8880 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG12512-RA 2054 CG12512-RA 180..1958 17..1795 8880 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5339541..5341001 1544..84 7290 99.9 Minus
2L 23513712 2L 5339228..5339482 1795..1541 1275 100 Minus
2L 23513712 2L 5341985..5342055 87..17 355 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:16:29 has no hits.

BO27328.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:25 Download gff for BO27328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12512-RA 295..2073 17..1797 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:29 Download gff for BO27328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12512-RA 180..1958 17..1797 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:14:27 Download gff for BO27328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12512-RA 180..1958 17..1797 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:14:27 Download gff for BO27328.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5341985..5342055 17..87 100   Minus
2L 5339545..5340997 88..1540 99 <- Minus
2L 5339225..5339482 1541..1797 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:29 Download gff for BO27328.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5341985..5342055 17..87 100   Minus
arm_2L 5339545..5340997 88..1540 99 <- Minus
arm_2L 5339225..5339482 1541..1797 99 <- Minus

BO27328.pep Sequence

Translation from 16 to 1813

> BO27328.pep
MNSKLQTISRYMLRQKCAFNSMRSISTSMPSLISHKHHIGKDPLVYRTIG
QQLELSASNFGDVEAIVSCHEGKRYSFKSLLQEADALAAGFRKLGLQPGD
AVGLWAPNYLHWYLGMMGAARAGLTSVGLNPAYQGPEIAYCLNKVNVKAI
IAPETFKTQNYYEILRDICPEISDADTGKIRSEKFPHLRSVIIDSNDSLK
GALRFDDFLDLASKSEREEVAKMQKSILPESACNIQFTSGTTGNPKAACL
THHNFVNNGIHVGNRNELEGERICVQVPMFHAFGVIISIMAALTKGATMV
LPAAGFSPKDSLQAIVNEKCSVIHGTPTMYVDLVNTQKKLQVPLGRIKKA
VTGGAIVSPQLIKDVRQVLNVEAVHSVYGLTETTAVIFQSLPGDSSDVVL
NSVGHLTDHIEAKVVDAEGRCVPFGQPGELCVRGYTTMLGYHDDEEKTKE
TIGNDRWLRTGDQFVLEANGYGRIVGRLKEMLIRGGENIFPKEIEDFLNA
HPQVIEAHVIGVPDERLGEEVCAYVRLEEGVDPASFTAETLKAYAKGKLA
HFKVPRYVIPIDAFPKTTSGKIQKFKLVEAFKAKETELKAARLASFLDH

BO27328.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG12512-PA 593 CG12512-PA 1..593 1..593 3067 100 Plus
pdgy-PC 597 CG9009-PC 101..595 73..581 456 28.5 Plus
pdgy-PB 597 CG9009-PB 101..595 73..581 456 28.5 Plus
pdgy-PD 597 CG9009-PD 101..595 73..581 456 28.5 Plus
pdgy-PA 597 CG9009-PA 101..595 73..581 456 28.5 Plus