Clone BO27337 Report

Search the DGRC for BO27337

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG3841-RA
Protein status:BO27337.pep: Imported from assembly
Sequenced Size:1726

Clone Sequence Records

BO27337.complete Sequence

1726 bp assembled on 2010-09-13

GenBank Submission: KX798854

> BO27337.complete
GAAGTTATCAGTCGACATGCCTCGATTTTTCCAGTTGACGTGGGCTCTTC
TTTTGATTTTAATAGGTTTCACCACTGCTGTTACTTTTATCGGAGATGAT
CCTGTGGTGGAGCTCTCCTTGGGCAGAATCCAAGGAGATACTATGCAGAG
CTTTGGGAACAAGACAATCTACGCATTCAGAGGAATACGATACGCGCAAT
CTCCAGTGGGACAGCTCCGGTTCGCCAATCCAGTTCCGGAAACTAGTTGG
GGTGACGAGGTGTTCAACGCAACATCGGATTCCCTCGTTTGTCCACAACC
AGGAGTAGTTTCTTTAATGAGTGAAGATTGCCTAAAGATCAACGTTTTCA
CGAAGAGCTTCGAGGACAAATTCCCAGTGATGGTGTATATTCATGGCGGA
GCCAATGTCCTGGGAAGTGGACACAGCAGCTATGAAGCAGGACCTCAATA
TTTGCTAGATCAGGACGTAGTTTTTGTGGCTTTTAACTATCGCCTTGGAG
CTCTGGGCTTTCTAAGCACAAATAGCAGTGAGACAAAGGGAAACTTTGGT
TTCCTCGATCAGGTGATGGCTCTGGAATGGGTAAGGGATCACATATCACA
CTTTGGTGGTGATCCAGAGTTGGTGACTATTATCGGAATAAGTGCTGGCT
CGATGGCAGTCAGTCTACACTTGGCCTCGCCCCTTTCCGCAGGTCTCTTC
CATCGGGCAATCCTCATGAGTGGATCGGCCACCAATCACTTTGATATAGA
TAACCTTTTTTGGACACGAAAACTGGCTCGTGAGCTGGGTTGTCCAATGT
ATGATCCCACGGATGTGGTGGAGTGTCTCCGAAACGAAACGTGGACACGC
ATTGTGGAAGTTTGCAAGGCATGGGAAACGTATCAGCTTGTTAATATGAA
GTGGAACTACGAGATCGATGGACACTTTCTACACAACCATCCTACGGAGC
TAATCAAGGAGGGAAATTTCAACAAGGTTCCCCTGCTAATCAGTTTCACG
GCCAATGAATTCGATTACAATGCAAATGTGCACTTGGAAAACCAGCATCT
ATTACACGATTTTGCCTCAAACTTTGTGGATTATGCCCCAGAGTTGTTTC
TCTATCGCCACGATGCACAAATTGGAGAGAAACTGAAGGATTTTTATCTA
GGTGACAATACTACGGAAATCAATTCGGAAAACATAGAGAACTTTGGACA
GATCTTTTCTGATGCATATATTGGGCATGGTGTCCATCGTCTGGTCCAAC
TAGCTAGTCACTTTACCCCAGTTTATTATACGCGAATGGATTACGTGGGT
GATCAAAGTCTCTCAGCTCCTTTGAATGGTGAAAACAAGCCCGTAGGAGT
GGGCCATGCGGATGATCTGCACTATGTGTTGCCGGGTTATTGGTATGGTC
CCTTAATGGCGGCAAATGATTCGGATGTTTTTATGATGGAACGTTTAACC
AGCTGGTTTACCCACTTTGCCAAAACAGGGACACCCCTAAACAGCACGGA
TATTTGGCCACCCTGCAACTCGACGGTCTTGAAGATGCTCTACAACGGGG
TGGTGACCCAGGTGGGTTCGCCCGGCTATTCGAATCGATATGCCGTCTGG
GACAAACTGTTTCCCACGGCCGCCCAGGGCGGAGGCGCTGCCTTGAAACT
CAGTTTCGCCGTGGCCATCGCCACTGGTGTGGCCTCCCGGCTCATCGGGA
AATTAATGGCAAGCTTTCTAGACCAT

BO27337.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3841-RB 1695 CG3841-PB 1..1692 17..1708 8460 100 Plus
CG3841-RA 1695 CG3841-PA 1..1692 17..1708 8460 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG3841-RB 2051 CG3841-RB 121..1812 17..1708 8460 100 Plus
CG3841-RA 1967 CG3841-RA 37..1728 17..1708 8460 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9589666..9590677 17..1028 5060 100 Plus
2L 23513712 2L 9590739..9591191 1028..1480 2265 100 Plus
2L 23513712 2L 9591315..9591544 1479..1708 1150 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:16:10 has no hits.

BO27337.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:24 Download gff for BO27337.complete
Subject Subject Range Query Range Percent Splice Strand
CG3841-RA 37..1728 17..1710 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:26 Download gff for BO27337.complete
Subject Subject Range Query Range Percent Splice Strand
CG3841-RA 37..1728 17..1710 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:14:23 Download gff for BO27337.complete
Subject Subject Range Query Range Percent Splice Strand
CG3841-RA 37..1728 17..1710 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:14:23 Download gff for BO27337.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9591316..9591544 1480..1710 99   Plus
2L 9590740..9591190 1029..1479 100 -> Plus
2L 9589666..9590677 17..1028 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:26 Download gff for BO27337.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9591316..9591544 1480..1710 99   Plus
arm_2L 9590740..9591190 1029..1479 100 -> Plus
arm_2L 9589666..9590677 17..1028 100 -> Plus

BO27337.pep Sequence

Translation from 16 to 1726

> BO27337.pep
MPRFFQLTWALLLILIGFTTAVTFIGDDPVVELSLGRIQGDTMQSFGNKT
IYAFRGIRYAQSPVGQLRFANPVPETSWGDEVFNATSDSLVCPQPGVVSL
MSEDCLKINVFTKSFEDKFPVMVYIHGGANVLGSGHSSYEAGPQYLLDQD
VVFVAFNYRLGALGFLSTNSSETKGNFGFLDQVMALEWVRDHISHFGGDP
ELVTIIGISAGSMAVSLHLASPLSAGLFHRAILMSGSATNHFDIDNLFWT
RKLARELGCPMYDPTDVVECLRNETWTRIVEVCKAWETYQLVNMKWNYEI
DGHFLHNHPTELIKEGNFNKVPLLISFTANEFDYNANVHLENQHLLHDFA
SNFVDYAPELFLYRHDAQIGEKLKDFYLGDNTTEINSENIENFGQIFSDA
YIGHGVHRLVQLASHFTPVYYTRMDYVGDQSLSAPLNGENKPVGVGHADD
LHYVLPGYWYGPLMAANDSDVFMMERLTSWFTHFAKTGTPLNSTDIWPPC
NSTVLKMLYNGVVTQVGSPGYSNRYAVWDKLFPTAAQGGGAALKLSFAVA
IATGVASRLIGKLMASFLDH

BO27337.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3841-PB 564 CG3841-PB 1..564 1..564 3011 100 Plus
CG3841-PA 564 CG3841-PA 1..564 1..564 3011 100 Plus
CG4757-PB 550 CG4757-PB 9..548 12..536 795 34.9 Plus
CG4757-PA 550 CG4757-PA 9..548 12..536 795 34.9 Plus
CG4382-PB 580 CG4382-PB 43..570 28..533 776 36 Plus