Clone BO27357 Report

Search the DGRC for BO27357

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG12402-RA
Protein status:BO27357.pep: Imported from assembly
Sequenced Size:1930

Clone Sequence Records

BO27357.complete Sequence

1930 bp assembled on 2010-09-13

GenBank Submission: KX794295

> BO27357.complete
GAAGTTATCAGTCGACATGGGGAATAGTCTGATAACGAGTGGAAAACCGA
GTCAGCGCCGTGAAAAGAGGCTTTTCGAGAGGCTGAGCTGCAGCTACGCT
CAGACCCCCAACAGAATGGAGTTGAACTTGAATCCCCTGCTGGCCATCGC
CCGTTCCATTGCGGCGCCACCGACACCGCCTCCAACCCCGGAAAAGTTGG
ACTCGGATAAGGATAAGGAGGGTTCCTCCAAAGCCGCCATCGAACTGCTG
CCTAACGAGATGTGGCTAGAGATCATGTCCTACCTTTCGTACAATGACCT
GCTGCAATTGCGGATGGTGTCCTGGCGGTGCCGTGATCTGGTTCATCGTC
GTCGATTCATGGAGAAAGGGAAGGTGATAGTGACGCAACACAACCTGGAG
GCGATCCACAAGCATGCGAAGGGCGGAAATTGCTATTTGAGCTTCGAGCG
GATTGAATTAAGAAATCTACGCCAGTGCCGCCAGTTGGAGAACTTTCTGC
GTCTTGTGGGCCACGAAGTGAAGCATCTGCAAGTGCGCCATGCTCCTGTT
TTCCGGAATCTGGATGGCAAGTTACCAAACCTTAAGGTTCTGACCATTGC
CACGACTATGTCGATGGATGACCAGCATCTGGCGGCGATGGATGACCTGG
ATATGAAGCAGTTTTCCCACCTTGTGGGATTCGAATGCGATGGCGTGAGT
TTGGACGCGGTGCTTAAGATGCGAATGTTGTTGCAGCTGCGACGAACGGA
GAACAAGGTGCAACTGCGGCACCTGCAATTCGAATTCCGGCGGAACAACG
AAAATGCTCTGCTGGATGTCCTACAGGATCATGCGGAAACCTTGGTGTGC
GTCAATTTATTCTTCAGCTGCTCGCCGGGCATTGATACGCGTGAATGGTG
CCGAGCGTTCGAAAATATGCACAATCTGCGAACTCTCAAGCTTTCGGGAA
ATTGTCATCTGGTCCTGTTGGAAGCTGTCCTAAGAGCCGTTCCGGAGTCA
GCACCAATCCGTCAACTGGATTTGACCGGAATGTTATCGCTAACCAACGA
ATTACTGCTCTATGTAGCTGGCAAGTGGCAAAGCACTCTGAAGGTGCTCG
ATCTAATGTTTTGTGTCCAACTCAACGCCAATTGCATTGATGCACTGCGC
CAGCTGAGTGGTCGGTTGGAGGCACTGACCATGGCTTACTGCAGAGAGCT
GACTGGAACGGGTTTGCTTCAAGGGCTGGCCGGCGATATTAACTACAGCC
TGCAGGAGCTGCATCTGGAGGAAACCATATTTTTGGACGAGAGCTCCATG
TGCCAGCTGCTGGAGCGACTGCCCAATCTTCGACGCCTCAGTTTGGATAA
CTGCCGCCAAGCGGTGACGGATCGCACAATGGCCACCATTTGCCAATACC
AGACAAGACTGAGAAATCTTAACATCGAATACTGTATGAAGATTACGGAT
CAAGGCCTGATGGGATATGGAGACACTCCCTATCCTATAAGTCGACTACG
CGGATTGAAGGAACTTAACCTTAGGGGCTGTCGCAATGTCACGGATAGTT
CTCTAATGGTTGGGCTGAAATTACCAGAGCTACGAGCCCTATCTTTGGGC
TACTGCAACCGTCTCACTTCAGAGGGATTTGAGGCATTGACCCAAAACTG
TCCATCCCTGGAGGCACTTTGTGTGTCCAGTTGCATGGCAGTGGATGATG
AGACTGTACTCAATATAGTAAGCAATCTAAAGCGTTTGCGAGTTCTCAAC
CTGAGCAACTGCACCAAGTTGACCCTGCAATCGATCCACCACATTCTGGC
GCATGGACACAATCTAGTCCAGCTGATCGCCTGCTCCATAGACGGCATGG
ATCATGAGCAGGCCCAGCGCATTCTAGAGTCGCAGCGACCACAAATGAAG
CAGGTGCTTCTAGCAAGCTTTCTAGACCAT

BO27357.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG12402-RC 2016 CG12402-PC 1..1896 17..1912 9480 100 Plus
CG12402-RB 1920 CG12402-PB 1..1896 17..1912 9480 100 Plus
CG12402-RA 1899 CG12402-PA 1..1896 17..1912 9480 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG12402-RC 3476 CG12402-RC 506..2402 16..1912 9485 100 Plus
CG12402-RB 3476 CG12402-RB 506..2402 16..1912 9485 100 Plus
CG12402-RA 3476 CG12402-RA 506..2402 16..1912 9485 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14106142..14107435 1395..102 6470 100 Minus
3R 32079331 3R 14105562..14106078 1912..1396 2585 100 Minus
3R 32079331 3R 14107729..14107816 103..16 440 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:14:33 has no hits.

BO27357.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:21 Download gff for BO27357.complete
Subject Subject Range Query Range Percent Splice Strand
CG12402-RA 1..1896 17..1914 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:21 Download gff for BO27357.complete
Subject Subject Range Query Range Percent Splice Strand
CG12402-RA 507..2402 17..1914 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:13:53 Download gff for BO27357.complete
Subject Subject Range Query Range Percent Splice Strand
CG12402-RA 507..2402 17..1914 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:13:53 Download gff for BO27357.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14107729..14107815 17..103 100   Minus
3R 14106142..14107433 104..1395 100 <- Minus
3R 14105558..14106078 1396..1914 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:21 Download gff for BO27357.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9933451..9933537 17..103 100   Minus
arm_3R 9931864..9933155 104..1395 100 <- Minus
arm_3R 9931280..9931800 1396..1914 99 <- Minus

BO27357.pep Sequence

Translation from 16 to 1930

> BO27357.pep
MGNSLITSGKPSQRREKRLFERLSCSYAQTPNRMELNLNPLLAIARSIAA
PPTPPPTPEKLDSDKDKEGSSKAAIELLPNEMWLEIMSYLSYNDLLQLRM
VSWRCRDLVHRRRFMEKGKVIVTQHNLEAIHKHAKGGNCYLSFERIELRN
LRQCRQLENFLRLVGHEVKHLQVRHAPVFRNLDGKLPNLKVLTIATTMSM
DDQHLAAMDDLDMKQFSHLVGFECDGVSLDAVLKMRMLLQLRRTENKVQL
RHLQFEFRRNNENALLDVLQDHAETLVCVNLFFSCSPGIDTREWCRAFEN
MHNLRTLKLSGNCHLVLLEAVLRAVPESAPIRQLDLTGMLSLTNELLLYV
AGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGL
LQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAV
TDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKEL
NLRGCRNVTDSSLMVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEA
LCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNL
VQLIACSIDGMDHEQAQRILESQRPQMKQVLLASFLDH

BO27357.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG12402-PC 671 CG12402-PC 1..632 1..632 3270 100 Plus
CG12402-PB 639 CG12402-PB 1..632 1..632 3270 100 Plus
CG12402-PA 632 CG12402-PA 1..632 1..632 3270 100 Plus
CG8272-PA 689 CG8272-PA 14..635 78..596 253 22.3 Plus
CG8272-PB 710 CG8272-PB 14..635 78..596 253 22.3 Plus
CG8272-PA 689 CG8272-PA 294..675 187..585 165 21.9 Plus