Clone BO27379 Report

Search the DGRC for BO27379

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptCG42288-RA
Protein status:BO27379.pep: Imported from assembly
Sequenced Size:514

Clone Sequence Records

BO27379.complete Sequence

514 bp assembled on 2010-08-18

GenBank Submission: KX796119

> BO27379.complete
GAAGTTATCAGTCGACATGGCCTGTCGCTGCAAATATCTGAAGCAGATCT
TTACCAAGTGCTGCTACTGCTATTCCCTGCGTTTCGGTGTGCTGCTCTTC
GGATGCATTTTTCTAACCTGGTTCATTTACATCACCATCGGCACCGGCTT
CATGATGGAGTGCATCTTTCCGAACGAGTATCAGAGGTCCCTTATCCCAG
CACCGGCGGCCCTCAAGGCCACCATGGTCTTCTCCTTCTTCGGCATCATA
GTTTCGGCCATGCTCTGCCTGGGAGTGCACAATAACAACGAGATGCTCTT
CCTGCCATTTTTGGTTTTCACACCCATTTGGATAATTGTGCACATTTTTG
CCCTGACCGTTTACAGCTTTAATACCATCATCATCATCCTGACTGTCATC
ACAATGTTACTTTTAGTGTATGCCTGGCTGGTGGTTTGGTCCTACTACAT
AGAACTGCTCTTCGCCTACGAAGATGAACTGGAAACCGGTTATGTGGCAA
GCTTTCTAGACCAT

BO27379.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG42288-RA 483 CG42288-PA 1..480 17..496 2400 100 Plus
CG42288-RB 474 CG42288-PB 1..471 17..496 2230 98.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG42288-RA 648 CG42288-RA 78..558 16..496 2405 100 Plus
CG42288-RB 639 CG42288-RB 78..549 16..496 2235 98.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14091108..14091375 16..283 1340 100 Plus
2R 25286936 2R 14091448..14091571 284..407 620 100 Plus
2R 25286936 2R 14091636..14091724 408..496 445 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:54:58 has no hits.

BO27379.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:52:37 Download gff for BO27379.complete
Subject Subject Range Query Range Percent Splice Strand
CG42288-RA 79..558 17..498 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:34 Download gff for BO27379.complete
Subject Subject Range Query Range Percent Splice Strand
CG42288-RA 79..558 17..498 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:22 Download gff for BO27379.complete
Subject Subject Range Query Range Percent Splice Strand
CG42288-RA 79..558 17..498 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:22 Download gff for BO27379.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14091636..14091724 408..498 97   Plus
2R 14091448..14091571 284..407 100 -> Plus
2R 14091109..14091375 17..283 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:34 Download gff for BO27379.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9979141..9979229 408..498 97   Plus
arm_2R 9978953..9979076 284..407 100 -> Plus
arm_2R 9978614..9978880 17..283 100 -> Plus

BO27379.pep Sequence

Translation from 16 to 514

> BO27379.pep
MACRCKYLKQIFTKCCYCYSLRFGVLLFGCIFLTWFIYITIGTGFMMECI
FPNEYQRSLIPAPAALKATMVFSFFGIIVSAMLCLGVHNNNEMLFLPFLV
FTPIWIIVHIFALTVYSFNTIIIILTVITMLLLVYAWLVVWSYYIELLFA
YEDELETGYVASFLDH

BO27379.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG42288-PA 160 CG42288-PA 1..160 1..160 856 100 Plus
CG42288-PB 157 CG42288-PB 1..157 1..160 830 98.1 Plus