Clone BO27383 Report

Search the DGRC for BO27383

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:83
Vector:pDNR-Dual
Associated Gene/TranscriptCG34454-RA
Protein status:BO27383.pep: Imported from assembly
Sequenced Size:433

Clone Sequence Records

BO27383.complete Sequence

433 bp assembled on 2010-08-18

GenBank Submission: KX793761

> BO27383.complete
GAAGTTATCAGTCGACATGTGCATCAATTGGCATCCAATATTTATTTTTG
CTTGTTTAAGTCAGTTGGGCGCAGCCCAAGAACCTTTAATTTTCGAAACA
TCTCGTAGCCCATGGAACAATGCCGCCGCAACGACGTCAATACCAATTTC
GCCCACCAGCGCAAACTTAGTTTTGGTTAACAATGTAAGAATACCAGGAG
GTCTTACACCATTTGTACCAGCACCGGCCCCAACCAAGGAATTTCTGAAC
TGCTTTGGTAACTGTCCCACCACATCGCAATACAATCCCATTTGCGGCAG
CAATATGCAGCTTTATATGAACGAGGAAAAATTTAATTGTGCTCGTTTCT
GTGGAGCTGACATTCAAATAGTTCGAAGAGGTTCTTGTGAGGGTCTTTTT
GCGATGACGCGAGGTGCAAGCTTTCTAGACCAT

BO27383.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG34454-RA 402 CG34454-PA 1..399 17..415 1995 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG34454-RA 603 CG34454-RA 49..447 17..415 1995 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 231960..232302 359..17 1715 100 Minus
3L 28110227 3L 231837..231893 415..359 285 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:55:09 has no hits.

BO27383.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:52:40 Download gff for BO27383.complete
Subject Subject Range Query Range Percent Splice Strand
CG34454-RA 1..399 17..417 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:38 Download gff for BO27383.complete
Subject Subject Range Query Range Percent Splice Strand
CG34454-RA 49..447 17..417 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:25 Download gff for BO27383.complete
Subject Subject Range Query Range Percent Splice Strand
CG34454-RA 49..447 17..417 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:25 Download gff for BO27383.complete
Subject Subject Range Query Range Percent Splice Strand
3L 231960..232302 17..359 100   Minus
3L 231834..231892 360..417 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:38 Download gff for BO27383.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 231960..232302 17..359 100   Minus
arm_3L 231834..231892 360..417 96 <- Minus

BO27383.pep Sequence

Translation from 16 to 433

> BO27383.pep
MCINWHPIFIFACLSQLGAAQEPLIFETSRSPWNNAAATTSIPISPTSAN
LVLVNNVRIPGGLTPFVPAPAPTKEFLNCFGNCPTTSQYNPICGSNMQLY
MNEEKFNCARFCGADIQIVRRGSCEGLFAMTRGASFLDH

BO27383.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34454-PA 133 CG34454-PA 1..133 1..133 726 100 Plus
Kaz1-ORFB-PF 114 CG1220-PF 1..113 3..125 194 38.9 Plus
Kaz1-ORFB-PE 114 CG1220-PE 1..113 3..125 194 38.9 Plus
Kaz1-ORFB-PA 114 CG1220-PA 1..113 3..125 194 38.9 Plus
Kaz1-ORFB-PH 115 CG1220-PH 1..101 3..113 171 39.5 Plus