Clone BO27387 Report

Search the DGRC for BO27387

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptFen1-RA
Protein status:BO27387.pep: Imported from assembly
Sequenced Size:1189

Clone Sequence Records

BO27387.complete Sequence

1189 bp assembled on 2010-08-18

GenBank Submission: KX796448

> BO27387.complete
GAAGTTATCAGTCGACATGGGAATTTTGGGCTTATCTAAGCTCATTGCCG
ATCTGGCGCCACAGGCGATTCGCGAAAGTGAGATGAAGCATTTTTTCGGT
CGCAAGGTAGCAATCGATGCTAGTATGTGCCTGTACCAGTTCCTCATCGC
CGTGCGCTCCGAAGGCGCCCAGTTGGCCACCGTAAATGGTGATCCCACGT
CCCACTTAATGGGCATGTTCTACCGCACCATCCGATTGCTGGACAACGGA
ATCAAGCCGGTATATGTCTTCGACGGAAAGCCACCAGATCTCAAGTCCGG
TGAGCTGGCGAAGCGCGCCGAGCGGCGGGAGGAAGCGGAGAAGGCACTGA
AGGCGGCCACCGATGCGGGAGATGATGCCGGTATCGAAAAGTTTAATCGC
CGATTGGTCCGGGTAACGAAGGAGCACGCCAAAGAGGCCAAGGAACTGCT
CACACTAATGGGTGTGCCCTATGTTGATGCACCGTGCGAAGCGGAGGCCC
AGTGTGCCGCTCTGGTGAAAGCTGGAAAGGTTTATGCCACCGCCACGGAG
GATATGGATGCCCTCACATTCGGATCTACAAAACTGTTGAGATACCTTAC
CTACAGCGAGGCACGAAAGATGCCCGTCAAGGAGTTCAGCTACGACAAGC
TGTTGGAAGGTCTGGCCATTAACAATCGAGAGTTCATTGATCTATGTATT
CTGCTGGGTTGCGATTACTGTGAGAGCATCAAGGGTATTGGACCCAAGCG
AGCGATCGAACTGATCAACACCTATCGGGATATAGAGACTATTCTGGATA
ACCTGGACTCTAGCAAATACACCGTGCCCGAGAACTGGAACTACAAGGTG
GCGCGGGAACTCTTCATCGAACCGGAGGTAGCTGATGCCGACTCCATAGA
TCTCAAATGGGTCGAGCCGGATGAGGAGGGCCTTGTCAAGTTTCTCTGCG
GCGACCGGCAGTTCAACGAAGAGCGCGTTCGCAACGGTGCCAAAAAGCTG
ATGAAATCCAAGCAGGCCCAGACTCAGGTGAGACTCGATAGCTTCTTTAA
GACACTGCCCAGCACTCCGAATGCCACAAACGCTGCAAAACGGAAGGCCG
AGGAAGCAAAGAAGAGCGCCAATAACAAAAAGGCCAAGACCAGCGGCGGT
GGACGAGGCCGGCGACCCAAGGCAAGCTTTCTAGACCAT

BO27387.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Fen1-RA 1158 CG8648-PA 1..1155 17..1171 5775 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Fen1-RA 1378 CG8648-RA 122..1281 12..1171 5785 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16854122..16855195 1171..98 5370 100 Minus
2R 25286936 2R 16855255..16855343 100..12 430 98.9 Minus
Blast to na_te.dros performed on 2014-11-28 08:55:15 has no hits.

BO27387.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:52:41 Download gff for BO27387.complete
Subject Subject Range Query Range Percent Splice Strand
Fen1-RA 1..1155 17..1173 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:40 Download gff for BO27387.complete
Subject Subject Range Query Range Percent Splice Strand
Fen1-RA 127..1281 17..1173 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:27 Download gff for BO27387.complete
Subject Subject Range Query Range Percent Splice Strand
Fen1-RA 127..1281 17..1173 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:27 Download gff for BO27387.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16855257..16855338 17..98 100   Minus
2R 16854120..16855194 99..1173 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:40 Download gff for BO27387.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12742762..12742843 17..98 100   Minus
arm_2R 12741625..12742699 99..1173 99 <- Minus

BO27387.pep Sequence

Translation from 16 to 1189

> BO27387.pep
MGILGLSKLIADLAPQAIRESEMKHFFGRKVAIDASMCLYQFLIAVRSEG
AQLATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKR
AERREEAEKALKAATDAGDDAGIEKFNRRLVRVTKEHAKEAKELLTLMGV
PYVDAPCEAEAQCAALVKAGKVYATATEDMDALTFGSTKLLRYLTYSEAR
KMPVKEFSYDKLLEGLAINNREFIDLCILLGCDYCESIKGIGPKRAIELI
NTYRDIETILDNLDSSKYTVPENWNYKVARELFIEPEVADADSIDLKWVE
PDEEGLVKFLCGDRQFNEERVRNGAKKLMKSKQAQTQVRLDSFFKTLPST
PNATNAAKRKAEEAKKSANNKKAKTSGGGRGRRPKASFLDH

BO27387.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
Fen1-PA 385 CG8648-PA 1..385 1..385 1970 100 Plus
Gen-PA 726 CG10670-PA 1..255 4..265 250 29.7 Plus
mus201-PD 1236 CG10890-PD 824..972 94..253 180 30 Plus
mus201-PC 1236 CG10890-PC 824..972 94..253 180 30 Plus
tos-PA 732 CG10387-PA 1..243 1..250 173 26.6 Plus