Clone BO27390 Report

Search the DGRC for BO27390

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptSfp23F-RA
Protein status:BO27390.pep: Imported from assembly
Sequenced Size:268

Clone Sequence Records

BO27390.complete Sequence

268 bp assembled on 2010-08-18

GenBank Submission: KX797278

> BO27390.complete
GAAGTTATCAGTCGACATGCGTTTATATAAAATATTCTGCCTAATTTGTT
CCATATTTGGCTGTGTTTCAGCTTTAAAAGATCCGAGCTGTGCTGTTGAG
TTGTTTGGCCAAGGTGCTTGCAACACTTTGATTACTCGAATCGGCTATTT
ACGTTGGGAAAACATGTGTACATCAAAGAACTTTGTTGCATGCGACACCG
ATGGAACTTCATTTGAGAGCATTAAGGAATGCGAAGATAAATGCAAAGAG
GCAAGCTTTCTAGACCAT

BO27390.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp23F-RA 237 CG42459-PA 1..234 17..250 1155 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp23F-RA 322 CG42459-RA 36..269 17..250 1155 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3387407..3387573 250..84 835 100 Minus
2L 23513712 2L 3387642..3387708 83..17 320 98.5 Minus
Blast to na_te.dros performed on 2014-11-28 08:55:28 has no hits.

BO27390.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:52:43 Download gff for BO27390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 36..269 17..252 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:45 Download gff for BO27390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 36..269 17..252 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:31 Download gff for BO27390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 36..269 17..252 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:31 Download gff for BO27390.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3387642..3387708 17..83 98   Minus
2L 3387405..3387573 84..252 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:45 Download gff for BO27390.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3387642..3387708 17..83 98   Minus
arm_2L 3387405..3387573 84..252 98 <- Minus

BO27390.pep Sequence

Translation from 16 to 268

> BO27390.pep
MRLYKIFCLICSIFGCVSALKDPSCAVELFGQGACNTLITRIGYLRWENM
CTSKNFVACDTDGTSFESIKECEDKCKEASFLDH

BO27390.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp23F-PA 78 CG42459-PA 1..78 1..78 430 100 Plus
CG42460-PB 79 CG42460-PB 1..78 1..78 212 52.6 Plus
CG42460-PA 79 CG42460-PA 1..78 1..78 212 52.6 Plus