Clone BO27394 Report

Search the DGRC for BO27394

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:94
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO27394.pep: Imported from assembly
Sequenced Size:754

Clone Sequence Records

BO27394.complete Sequence

754 bp assembled on 2010-08-18

> BO27394.complete
GAAGTTATCAGTCGACATGCTATCGCTGCTAGACCAGCCGTCCGCATCGC
GAGGGTGGGATTCAACCATGTCAAAGCCAGCTCTGTATTATGCCACCCTA
AGTCCCCCATCGCGCGCCGTCCTCCTCACGGCTAAGGCGATCGGACTCGA
CCTTGAACTACGGCCAATTAACCTGCTGAAGGGAGAGCATCTGACTCCGG
AATTCCTCAAGCTGAACCCCCAGCACACCATCCCGACCCTGATCGACGGC
GAGGCCACTATCATTGACTCGCACGCCATCTGCGCCTACCTGGTGGAGAA
GTATGGCCAGAAGGAGCAGCAGCTCTATCCGAAGGAATTGGTGCAGCGCG
CCAACGTGGATGCTCGGCTCCATCTGGACTCCGGCCACCTCTTCGCGCGC
CTGCGCTTCCTTTACGAGCCCATCCTGTATTATGGATCGACGGACTGCTC
CATCGACAAGATCGCATACATCCAGAAGTGCTGGGAGATCCTAGAGGGAT
TCCTCAAGGATCAGCCGTATTTGTGTGGTTCTGATCTAACCATCGCAGAC
TTTTGCGCCGTGGCCACCGTAACCTCGGTGAACGACACCGCTCCCATCGA
TGAATTTAAGTTTCCCAAGATGCACGCCTGGCTGAAGCGTCTGGCAGAGC
TACCCTACTACCAGGAGGTAAACGGCGACGGCGCTGACGAGCTTAAGAGC
ATCTTCAAGGCCAAGCTGGCAGAAAACCGTGGCAAGGCAAGCTTTCTAGA
CCAT

BO27394.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
GstE12-RC 672 CG16936-PC 1..669 68..736 3345 100 Plus
GstE12-RB 672 CG16936-PB 1..669 68..736 3345 100 Plus
GstE12-RD 672 CG16936-PD 1..669 68..736 3345 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
GstE12-RC 1311 CG16936-RC 492..1211 17..736 3600 100 Plus
GstE12-RD 907 CG16936-RD 130..807 59..736 3390 100 Plus
GstE12-RB 1022 CG16936-RB 220..896 60..736 3385 100 Plus
GstE12-RD 907 CG16936-RD 27..69 17..59 215 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24766844..24767418 736..162 2875 100 Minus
2R 25286936 2R 24767474..24767578 163..59 525 100 Minus
2R 25286936 2R 24767639..24767681 59..17 215 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:55:45 has no hits.

BO27394.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:52:46 Download gff for BO27394.complete
Subject Subject Range Query Range Percent Splice Strand
CG16936-RA 56..732 60..738 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:50 Download gff for BO27394.complete
Subject Subject Range Query Range Percent Splice Strand
GstE12-RC 494..1213 17..738 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:36 Download gff for BO27394.complete
Subject Subject Range Query Range Percent Splice Strand
GstE12-RC 492..1211 17..738 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:36 Download gff for BO27394.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24767639..24767681 17..59 100   Minus
2R 24767475..24767577 60..162 100 <- Minus
2R 24766842..24767417 163..738 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:50 Download gff for BO27394.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20655162..20655204 17..59 100   Minus
arm_2R 20654998..20655100 60..162 100 <- Minus
arm_2R 20654365..20654940 163..738 99 <- Minus

BO27394.pep Sequence

Translation from 16 to 754

> BO27394.pep
MLSLLDQPSASRGWDSTMSKPALYYATLSPPSRAVLLTAKAIGLDLELRP
INLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKE
QQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIA
YIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFP
KMHAWLKRLAELPYYQEVNGDGADELKSIFKAKLAENRGKASFLDH

BO27394.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
GstE12-PC 223 CG16936-PC 1..223 18..240 1169 100 Plus
GstE12-PB 223 CG16936-PB 1..223 18..240 1169 100 Plus
GstE12-PD 223 CG16936-PD 1..223 18..240 1169 100 Plus
GstE12-PA 223 CG16936-PA 1..223 18..240 1169 100 Plus
GstE11-PB 225 CG5224-PB 3..225 19..240 566 49.3 Plus