Clone BO27404 Report

Search the DGRC for BO27404

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:274
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG15629-RA
Protein status:BO27404.pep: Imported from assembly
Sequenced Size:1009

Clone Sequence Records

BO27404.complete Sequence

1009 bp assembled on 2010-08-18

GenBank Submission: KX796665

> BO27404.complete
GAAGTTATCAGTCGACATGACCGCCTCACCGGGTCTTCTGCACATGGATC
AACCGCTCAGAGCCATCTATCAATTCTTACTCGACTTGCTAGTGTTTACG
ATTAAATCGGTGTACTACGTACTCGAATCGATTTACTACAGTCTGTTGCC
GCAGCGCTTTCGAAAGTTAAAGGACATCTCCGGCCAGGTGGTGCTCATCA
CAGGAGGAGGCGGTGGTGTTGGACGTTTGATTGCCCTAAACTTTGCTCGC
CTTCAGGCCCGCATTGTCATCTGGGATATAAATCAAGAAGCCATAAAGAC
AACTGTGGATTTGTTGGCCAAACATGGTTATGACAACTGCAAGGGCTACG
TTGTGGACATCTCAGATCGGGAGCAGATCTACCAGCGTGCCAGCCAGGTG
ACCGAGGAGGTTGGTCCCGTCGACATATTGATTAACAATGCCGGTATCGT
GTGCTGCAAACCCTTCTGGGAGCTGCACGATCGGGTCATCCAGAACACGT
ACAACATTAACATCATATCGCACTACTGGACCGTGAAAGCGTTTCTGCCT
CACATGATGCGCAATAATCGTGGTCATATCGTTACTGTGGGCTCGGTAAC
TGGAATGCTGGGCACCTACGGATGCAGTGACTACGCGGCCACCAAATACG
CCTGCATCGGTTTCCACGAGAGTTTGCTCACCGATCTGAAGGCCCATGGC
TATGATCAAATCCAAATGAGTTTGATCTGCCCGTACTACATCAACACGGG
CATGTTTTCGGGTGTTCGGCCGCGGATGATGCCCATGCTGGAGCCGCAGT
ATGTGGCGGATCGCATCGAGAACGCCGTGCGCTGCAACGAGGTGTGGTGC
GTGCTGCCCAACTCTATTCGCCTGCTCACTCCTCTCAAATGTCTTTTGCC
CGCCAAAATGTGCTGGGAGCTGATGTCGCGTGTCATCCGTGGACCCGAGT
CTATGATGATGTTTCAGGGACGAGGGCGCGTCGCCGCTGGTGCAAGCTTT
CTAGACCAT

BO27404.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15629-RA 978 CG15629-PA 1..975 17..991 4875 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15629-RA 1432 CG15629-RA 345..1320 16..991 4880 100 Plus
CG3225-RA 2387 CG3225-RA 2221..2321 991..891 505 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4815021..4815623 289..891 3015 100 Plus
2L 23513712 2L 4813353..4813510 16..173 790 100 Plus
2L 23513712 2L 4814768..4814887 171..290 600 100 Plus
2L 23513712 2L 4815679..4815779 891..991 505 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:40:43 has no hits.

BO27404.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:41 Download gff for BO27404.complete
Subject Subject Range Query Range Percent Splice Strand
CG15629-RA 330..1304 17..993 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:29 Download gff for BO27404.complete
Subject Subject Range Query Range Percent Splice Strand
CG15629-RA 346..1320 17..993 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:15 Download gff for BO27404.complete
Subject Subject Range Query Range Percent Splice Strand
CG15629-RA 346..1320 17..993 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:15 Download gff for BO27404.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4815680..4815779 892..993 98   Plus
2L 4815023..4815623 291..891 100 -> Plus
2L 4814770..4814887 173..290 100 -> Plus
2L 4813354..4813509 17..172 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:29 Download gff for BO27404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4815680..4815779 892..993 98   Plus
arm_2L 4815023..4815623 291..891 100 -> Plus
arm_2L 4814770..4814887 173..290 100 -> Plus
arm_2L 4813354..4813509 17..172 100 -> Plus

BO27404.pep Sequence

Translation from 16 to 1009

> BO27404.pep
MTASPGLLHMDQPLRAIYQFLLDLLVFTIKSVYYVLESIYYSLLPQRFRK
LKDISGQVVLITGGGGGVGRLIALNFARLQARIVIWDINQEAIKTTVDLL
AKHGYDNCKGYVVDISDREQIYQRASQVTEEVGPVDILINNAGIVCCKPF
WELHDRVIQNTYNINIISHYWTVKAFLPHMMRNNRGHIVTVGSVTGMLGT
YGCSDYAATKYACIGFHESLLTDLKAHGYDQIQMSLICPYYINTGMFSGV
RPRMMPMLEPQYVADRIENAVRCNEVWCVLPNSIRLLTPLKCLLPAKMCW
ELMSRVIRGPESMMMFQGRGRVAAGASFLDH

BO27404.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15629-PA 325 CG15629-PA 1..325 1..325 1722 100 Plus
CG9265-PD 399 CG9265-PD 56..337 23..307 580 39.6 Plus
CG9265-PC 399 CG9265-PC 56..337 23..307 580 39.6 Plus
CG9265-PB 399 CG9265-PB 56..337 23..307 580 39.6 Plus
CG9265-PA 399 CG9265-PA 56..337 23..307 580 39.6 Plus