Clone BO27413 Report

Search the DGRC for BO27413

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:274
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptSytalpha-RB
Protein status:BO27413.pep: Imported from assembly
Sequenced Size:1546

Clone Sequence Records

BO27413.complete Sequence

1546 bp assembled on 2010-08-18

GenBank Submission: KX794886

> BO27413.complete
GAAGTTATCAGTCGACATGACAACACATTCACTCTCAGCCGGAGAAATGG
ACATTGTCATACGTGAGGAGGACATTTCTTTGGCCCAAATTGGCGTCTAT
GCCTCTGTGTCCTTTCTCGTTGTTTCTGCAGTTGGGGCAGCGCTGTATAC
CACCTGCTCAAAACGCTATCGCCTGAACTGGTTCGAACAAAATCTCCTGG
AGTCCGCCAACGAAAAGGATGAAGATCAGCAAAGGGAGGCTTTGGTTGCC
GGTGCCGTGGGCTACAATGTGGACAACGTGAACGAGGTACCGCGTGGGAA
ATACAGCAGCGGAAATGCCGGTAACCTCAGCCCCACCTCTCTGAAAAGCG
AGGACAATGACCCGGCCTTTTGGGTGCCGGCTTCAGTCACCTCCACGGCA
GCCATCCAGCAACAAGTGTCCAATACCACCGAGGAGTCCGCACCGCCAAC
ATCACCCACCGGGAGCCTGAAGTCAAACACCTTGTCCTACTGTTCCACCA
CCTCCGTGCCAATCGCGAGATCTGATAAGCATGTGGTCCTTGCTATGCAT
CCGAGCCGTCCCAGAGTTTCCTCTATGAACGCCAAGCTGGATCACACCAA
AATCGACATGACCTTGTATAGAAGTCATTCTCAGCCGAAGACTATCAATC
CAGTTTCACTCAACGAAGTTCGGGGTAATTTGCATGTGAGTCTTGGCTAC
GATCCAGTTGGAGGATTGCTAAATGTTCGACTCCTGGAGGCCCAGAATCT
GCAACCGAGGCAATTTAGTGGAACTGCCGACCCATATGCCAAAGTCCGCT
TGCTGCCGGATAAAAAGAACTTTTGGCAGACGCGTATACACAAGAGGACC
CTGAATCCAGTTTTCGACGAGCAGTTTGTTTTTGAGGTAACAGCCGGAGT
AATTGACAAGCGTACTGTGGAAATTTTACTATACGACTTTGATGCTTATT
CCCGGCACGTTTGCATCGGAGGAAGTAAGCTACATTTGGCCAACTTGGAT
CTCAGCGAGCAATTGAAGTTGTGGACTCCTCTTAGTTCTGCCTCGGCCCA
AGATATGAAGGTGGATTTGGGCGATATAATGGTGTCCCTAGCCTATTTGC
CATCAGCGGAGCGTTTGATGGTCGTCCTTATCAAGGCACGAAACCTGCGG
ATTGTCGACGATGCCCGGAACTCCTCGGACCCTTATGTAAAGGTAACCCT
CCTCGGTCCCGGTGGCAAAAAGATAAAGAAACGCAAGACGGGCGTTCAAA
GGGGCACCCTGAACCCAGTCTATAATGAGGCTCTTGCTTTCGATGTGGCC
AAGGAGACTTTAAAAAACTGTGTACTAGAATTCACCGTAGTCCACGATGG
CCTATTGGGATCAAGTGAAATATTAGGACGAACTCTCATTGGAAACTCTC
CGGAAGTACGCACCGAGGAAAAAATATTTTTTGAAGAAGTTTTTCGTGCC
AAAAATGCTACGGCTCAATGGGTTCCACTGCAAGAACCGGCAAACAATTT
GGCCACATCGGCCAAAAGTTCAAAGAACGCAAGCTTTCTAGACCAT

BO27413.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Sytalpha-RB 1515 CG5559-PB 1..1512 17..1528 7560 100 Plus
Sytalpha-RC 1485 CG5559-PC 1..1482 47..1528 7410 100 Plus
Sytalpha-RA 1485 CG5559-PA 1..1482 47..1528 7410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Sytalpha-RB 1931 CG5559-RB 65..1576 17..1528 7560 100 Plus
Sytalpha-RC 2189 CG5559-RC 333..1834 27..1528 7510 100 Plus
Sytalpha-RA 2037 CG5559-RA 181..1682 27..1528 7510 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17602203..17602704 858..1359 2510 100 Plus
2L 23513712 2L 17601451..17601843 233..625 1965 100 Plus
2L 23513712 2L 17601912..17602146 626..860 1175 100 Plus
2L 23513712 2L 17600941..17601149 27..235 1045 100 Plus
2L 23513712 2L 17603115..17603285 1358..1528 855 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:40:49 has no hits.

BO27413.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:42 Download gff for BO27413.complete
Subject Subject Range Query Range Percent Splice Strand
CG5559-RA 174..1682 20..1530 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:30 Download gff for BO27413.complete
Subject Subject Range Query Range Percent Splice Strand
Sytalpha-RB 65..1576 17..1530 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:18 Download gff for BO27413.complete
Subject Subject Range Query Range Percent Splice Strand
Sytalpha-RB 65..1576 17..1530 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:18 Download gff for BO27413.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17603116..17603285 1359..1530 98   Plus
2L 17602206..17602703 861..1358 100 -> Plus
2L 17601912..17602146 626..860 100 -> Plus
2L 17601453..17601843 235..625 100 -> Plus
2L 17600938..17601148 24..234 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:30 Download gff for BO27413.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17603116..17603285 1359..1530 98   Plus
arm_2L 17602206..17602703 861..1358 100 -> Plus
arm_2L 17601912..17602146 626..860 100 -> Plus
arm_2L 17601453..17601843 235..625 100 -> Plus
arm_2L 17600938..17601148 24..234 99 -> Plus

BO27413.pep Sequence

Translation from 16 to 1546

> BO27413.pep
MTTHSLSAGEMDIVIREEDISLAQIGVYASVSFLVVSAVGAALYTTCSKR
YRLNWFEQNLLESANEKDEDQQREALVAGAVGYNVDNVNEVPRGKYSSGN
AGNLSPTSLKSEDNDPAFWVPASVTSTAAIQQQVSNTTEESAPPTSPTGS
LKSNTLSYCSTTSVPIARSDKHVVLAMHPSRPRVSSMNAKLDHTKIDMTL
YRSHSQPKTINPVSLNEVRGNLHVSLGYDPVGGLLNVRLLEAQNLQPRQF
SGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVIDKRT
VEILLYDFDAYSRHVCIGGSKLHLANLDLSEQLKLWTPLSSASAQDMKVD
LGDIMVSLAYLPSAERLMVVLIKARNLRIVDDARNSSDPYVKVTLLGPGG
KKIKKRKTGVQRGTLNPVYNEALAFDVAKETLKNCVLEFTVVHDGLLGSS
EILGRTLIGNSPEVRTEEKIFFEEVFRAKNATAQWVPLQEPANNLATSAK
SSKNASFLDH

BO27413.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
Sytalpha-PB 504 CG5559-PB 1..504 1..504 2565 100 Plus
Sytalpha-PC 494 CG5559-PC 1..494 11..504 2515 100 Plus
Sytalpha-PA 494 CG5559-PA 1..494 11..504 2515 100 Plus
Sytalpha-PD 494 CG5559-PD 1..494 11..504 2515 100 Plus
Syt1-PI 472 CG3139-PI 192..461 220..491 471 38 Plus