Clone BO27424 Report

Search the DGRC for BO27424

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:274
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptCyp313a1-RA
Protein status:BO27424.pep: Imported from assembly
Sequenced Size:1510

Clone Sequence Records

BO27424.complete Sequence

1510 bp assembled on 2010-08-18

GenBank Submission: KX795515

> BO27424.complete
GAAGTTATCAGTCGACATGTTAACTATCAATTTGTTACTGGCGGTCGGAG
CTCTTTTTTGGATTTATTTCTTATGGAGTCGCCGAAGGTTATATTTCCTG
ATGCTAAAGATTCCCGGACCCATAGGACTACCCATTTTGGGTAGCTCCCT
GGAAAATATCATCACCTATAAACGTAAACTAAGCTTTCGAACAAAGTATT
TGAATAAGTACGGCTCGACTATTTTAACGTGGATGGGTCCGGTGCCATTT
ATAGTGACACGAGATCCGAAAGTCGTTGAGGATATCTTTTCGTCTCCTGA
TTGCCACAACAAGAGCCAGCATATTGTGAATGCCATAACTTCTTGTATGG
GAAATGGATTGCTGGGAAAACAAGATCCTCATTGGCTTGATCGCCGCAAG
CACTTTAACCCATCGTTTAAACAGGATCTTTTGCTTAGCTTCTTTCACAT
TTTCGATGCCGAGACGAAAGTCCTGATGAATTTACTAGATACTTATGTCG
ACAAAGGCGAAATAGATGTGGTTCCAGAGATGCTTAGATGGTCTTTTAAA
ATAGCCGCCCAAACCACAATGGGTTCTGAAGTTAAACATGATGAGCACTT
CAAAAATGGCAGCCTCGTGGAAAGCTTCGAATCGCTCATATCTCATTCGA
CTCTCAATATATTGATGCCCTTGGTTCAAAACAGGATGATTTCAAAAATA
TGCGGTTATGATAAGTTACGAGCTGACAACTTTTCTAGAATTCAAAAAAT
GTTGGACAACGTGGTTAATAAAAAAGTCAATCCATTGCCAAAGACTGATT
CAGATCCCGAATCGAACATTGTGATCAATAGGGCAATGGAACTGTACCGT
AAAGGCGATATCACCTATATGGATGTGAAGAGCGAATGTTGTATAATGAT
TGCCGCCGGCTATGATACATCAGCTCTAACAGTTTATCACGCACTCTTCC
TACTGGCCAATCATCCCGAGCACCAGGAAGCGGTCTTTGAGGAGCTAAAT
GGTGTCTTCCCAGATGCCGGACACTTTGGAATAACATACCCAGATATGCA
GAAACTGGACTACTTGGAGCGCGTGATAAAGGAGACACTACGCCTGATAC
CTGCTATTCCAATAACAGCAAGGGAAACAAAGAATGATGTTCGTCTCTCG
AATGGAGTTCTCATTCCCAAAGGAGTCGTCATCGGCATCGACATGTTTCA
CACTCACAGAAATCCCGAAGTCTGGGGACCAGATGCAGACAACTTTAATC
CGGATAACTTCTTGGCGGAAAACATGGAACAAAAGCACCCATATGCCTAC
ATTCCATTTGCGAGGGGAAAGAGAAATTGCATTGGGTCAAAATATGCAAT
GATGTCTTCAAAGTTTGCCTTATGCAGAATACTCAGGAACTACAAGATTA
GCACAAGCACTCTCTACAAGGATCTGGTTTATGTGGACAACATGACCATG
AAACTGGCTGAGTATCCTCGACTTAAACTTCAACGACGCGGTGCAAGCTT
TCTAGACCAT

BO27424.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp313a1-RA 1479 CG3360-PA 1..1476 17..1492 7380 100 Plus
Cyp313a2-RB 1482 CG10094-PB 1135..1380 1151..1396 240 73.2 Plus
Cyp313a3-RA 1479 CG10093-PA 39..289 55..305 190 71.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp313a1-RA 1623 CG3360-RA 55..1530 17..1492 7380 100 Plus
Cyp313a2-RB 1577 CG10094-RB 1140..1385 1151..1396 240 73.2 Plus
Cyp313a3-RA 1777 CG10093-RA 196..446 55..305 190 71.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14522173..14522747 761..1335 2875 100 Plus
3R 32079331 3R 14521338..14521538 174..374 1005 100 Plus
3R 32079331 3R 14521601..14521788 373..560 940 100 Plus
3R 32079331 3R 14521103..14521264 17..178 810 100 Plus
3R 32079331 3R 14522813..14522971 1334..1492 795 100 Plus
3R 32079331 3R 14521996..14522131 634..769 650 98.5 Plus
3R 32079331 3R 14521850..14521923 561..634 370 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:41:00 has no hits.

BO27424.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:45 Download gff for BO27424.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp313a1-RA 38..1508 22..1494 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:36 Download gff for BO27424.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp313a1-RA 60..1530 22..1494 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:21 Download gff for BO27424.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp313a1-RA 60..1530 22..1494 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:21 Download gff for BO27424.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14522814..14522971 1335..1494 98   Plus
3R 14522173..14522746 761..1334 100 -> Plus
3R 14521996..14522122 634..760 100 -> Plus
3R 14521850..14521922 561..633 100 -> Plus
3R 14521603..14521788 375..560 100 -> Plus
3R 14521338..14521538 174..374 100 -> Plus
3R 14521108..14521259 22..173 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:36 Download gff for BO27424.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10348536..10348693 1335..1494 98   Plus
arm_3R 10347895..10348468 761..1334 100 -> Plus
arm_3R 10347718..10347844 634..760 100 -> Plus
arm_3R 10347572..10347644 561..633 100 -> Plus
arm_3R 10347325..10347510 375..560 100 -> Plus
arm_3R 10347060..10347260 174..374 100 -> Plus
arm_3R 10346830..10346981 22..173 100 -> Plus

BO27424.pep Sequence

Translation from 16 to 1510

> BO27424.pep
MLTINLLLAVGALFWIYFLWSRRRLYFLMLKIPGPIGLPILGSSLENIIT
YKRKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKS
QHIVNAITSCMGNGLLGKQDPHWLDRRKHFNPSFKQDLLLSFFHIFDAET
KVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEVKHDEHFKNGSL
VESFESLISHSTLNILMPLVQNRMISKICGYDKLRADNFSRIQKMLDNVV
NKKVNPLPKTDSDPESNIVINRAMELYRKGDITYMDVKSECCIMIAAGYD
TSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYL
ERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNP
EVWGPDADNFNPDNFLAENMEQKHPYAYIPFARGKRNCIGSKYAMMSSKF
ALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPRLKLQRRGASFLDH

BO27424.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp313a1-PA 492 CG3360-PA 1..492 1..492 2595 100 Plus
Cyp313a3-PA 492 CG10093-PA 1..491 1..491 1443 53.6 Plus
Cyp313a2-PB 493 CG10094-PB 1..491 1..491 1334 48.5 Plus
Cyp313a5-PA 487 CG15807-PA 1..486 1..491 1201 45.8 Plus
Cyp313a4-PA 494 CG6802-PA 1..493 1..491 1085 41.5 Plus