Clone BO27447 Report

Search the DGRC for BO27447

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:274
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG10866-RA
Protein status:BO27447.pep: Imported from assembly
Sequenced Size:706

Clone Sequence Records

BO27447.complete Sequence

706 bp assembled on 2010-08-18

GenBank Submission: KX798804

> BO27447.complete
GAAGTTATCAGTCGACATGCCCCACTGCCACACAATGGTCTATATGCGAA
TTGTGCTAACAACCTTGGTGACCATTACGTGTCTGCTGGGGGACAACTTT
GTGGAGCTGACCCAGCATCCATTGCTGAAGGCCCTGGCCGACAATGCCAC
CCATGCGGCCATTGGAGCACTCACGGGAATCACGTTCGCCACACAATTCT
ACGAGCGCACCTCGCAGTTGTTCGGCTGGATATTGATTTTCACCTGCTTC
GTTGTGTCATCGTTCATTGACTTGGACCACTTTGTGGAGGCTCGTTCCCT
TTATTTGGAGGATGCCACCAATCTGTCGAAGAGGCCCTTCCTCCACTGCT
CCAGCATTATAGTGGTTATGCTGCTGTTCTACATGTGCACCGCCTGTTTG
AACTATTTCCGGACCAGCCTAATGCTGGGATCCCTACTCTGTGCCTTCAT
CACACACCACACCAGGGACGCCGTGCGGCGGGGCTACTGGCTGTGCCCGC
TAGGTCACACGGACAGGATGCCCCAGCTAGCCTACATATTGACCACCATC
CTGACGCCCCATCTGCTGGGCTGCCTGCACAACGTGTGCCGCAGCGCAAC
CGTGCTTAACTTCCTGGGGCAGTACGTCAAGCTAAGCGAGGGCCAATACC
GCAGCGGCTCCACTGCCAACTATCGCTACATGCAGGTCGCAAGCTTTCTA
GACCAT

BO27447.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG10866-RB 675 CG10866-PB 1..672 17..688 3360 100 Plus
CG10866-RA 675 CG10866-PA 1..672 17..688 3360 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG10866-RB 1874 CG10866-RB 247..918 17..688 3360 100 Plus
CG10866-RA 1337 CG10866-RA 247..918 17..688 3360 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3937016..3937395 688..309 1900 100 Minus
3L 28110227 3L 3937452..3937746 311..17 1475 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:41:06 has no hits.

BO27447.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:46 Download gff for BO27447.complete
Subject Subject Range Query Range Percent Splice Strand
CG10866-RA 196..867 17..690 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:38 Download gff for BO27447.complete
Subject Subject Range Query Range Percent Splice Strand
CG10866-RA 196..867 17..690 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:23 Download gff for BO27447.complete
Subject Subject Range Query Range Percent Splice Strand
CG10866-RA 247..918 17..690 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:23 Download gff for BO27447.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3937453..3937746 17..310 100   Minus
3L 3937014..3937393 311..690 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:38 Download gff for BO27447.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3937453..3937746 17..310 100   Minus
arm_3L 3937014..3937393 311..690 99 <- Minus

BO27447.pep Sequence

Translation from 16 to 706

> BO27447.pep
MPHCHTMVYMRIVLTTLVTITCLLGDNFVELTQHPLLKALADNATHAAIG
ALTGITFATQFYERTSQLFGWILIFTCFVVSSFIDLDHFVEARSLYLEDA
TNLSKRPFLHCSSIIVVMLLFYMCTACLNYFRTSLMLGSLLCAFITHHTR
DAVRRGYWLCPLGHTDRMPQLAYILTTILTPHLLGCLHNVCRSATVLNFL
GQYVKLSEGQYRSGSTANYRYMQVASFLDH

BO27447.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG10866-PB 224 CG10866-PB 1..224 1..224 1189 100 Plus
CG10866-PA 224 CG10866-PA 1..224 1..224 1189 100 Plus