Clone BO27471 Report

Search the DGRC for BO27471

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:274
Well:71
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO27471.pep: Imported from assembly
Sequenced Size:589

Clone Sequence Records

BO27471.complete Sequence

589 bp assembled on 2010-08-18

> BO27471.complete
GAAGTTATCAGTCGACATGGCAGGGTCCATCCGTTTCAGAATGGGTCCAA
TTACACTATTGCTTTCGATACTCTTGGTTCATAGTTGTCGAGCCGAAAAG
CCGTACAGTGTGGAGCTAAACACCTTTACGATGGACGACACCATCGAAAA
TCAGGAAAATTGGGTAGACTGGGGAACGCTGAGTATGAAAAAGGTCTCAC
GAAATCAATTTGTGGTTAGCGGAGACTTTGAATTCAAACTCAATATGGCC
GATGAGCAGAAGATTGTTCTCATGGTTTATGTCTACGATTCCAATGCCAA
TCAAAGGGGTTCGATGGTAATGGCTGTTAAAAAGCCGTTCTGTCAGTTCA
TTAAAGAGGATGAGGACTCGTATCCAAGCATACAAAAGGCTTCCAATTTA
CCGGATCAGGATACGTGCCCATTTCCGAAAGGCAAATATACTATCGATAA
CTACGAATTGGAGACCAATTTCCTACCGGACAATGCACCCAAAGGCGACT
ATCTGTTGCAGTTATCCTTGTTGGATCGTGAGGTCCCAGTAGCAGGACTT
GTGGCTACTGTTACCCTGACTGCAAGCTTTCTAGACCAT

BO27471.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
CheA7a-RA 534 CG15033-PA 1..531 41..571 2640 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
CheA7a-RA 721 CG15033-RA 10..564 17..571 2760 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7378486..7378796 261..571 1540 99.7 Plus
X 23542271 X 7378149..7378394 17..262 1230 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:56:12 has no hits.

BO27471.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:49 Download gff for BO27471.complete
Subject Subject Range Query Range Percent Splice Strand
CheA7a-RA 1..531 41..573 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:10 Download gff for BO27471.complete
Subject Subject Range Query Range Percent Splice Strand
CheA7a-RA 10..564 17..573 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:03 Download gff for BO27471.complete
Subject Subject Range Query Range Percent Splice Strand
CheA7a-RA 10..564 17..573 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:03 Download gff for BO27471.complete
Subject Subject Range Query Range Percent Splice Strand
X 7378488..7378796 263..573 99   Plus
X 7378149..7378394 17..262 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:10 Download gff for BO27471.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7272521..7272829 263..573 99   Plus
arm_X 7272182..7272427 17..262 100 -> Plus

BO27471.pep Sequence

Translation from 16 to 589

> BO27471.pep
MAGSIRFRMGPITLLLSILLVHSCRAEKPYSVELNTFTMDDTIENQENWV
DWGTLSMKKVSRNQFVVSGDFEFKLNMADEQKIVLMVYVYDSNANQRGSM
VMAVKKPFCQFIKEDEDSYPSIQKASNLPDQDTCPFPKGKYTIDNYELET
NFLPDNAPKGDYLLQLSLLDREVPVAGLVATVTLTASFLDH

BO27471.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
CheA7a-PA 177 CG15033-PA 1..177 9..185 925 100 Plus