Clone BO27485 Report

Search the DGRC for BO27485

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:274
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG3649-RB
Protein status:BO27485.pep: Imported from assembly
Sequenced Size:1492

Clone Sequence Records

BO27485.complete Sequence

1492 bp assembled on 2010-08-18

GenBank Submission: KX797673

> BO27485.complete
GAAGTTATCAGTCGACATGACGATAAAATCGTTCAACTTGGTGGTAAAGG
GTCCCATGTGGGGCGTTCGCCACCTGCAGGTACTGTTCCTCTTTCTGTGC
GCCACCTTGATCGTGGCCCAGAGGTTCAACATGAGCGTGGCCATTGTGGC
CTTTACGAATGCCAATAGCAGCAACCCAAATTATCCGGAATACCGACTGA
CAGAGCCTCAGAAGTCGTACACCATCAGCAGTCCCTTCTGGGGCTCCTGC
TGCACCCAGATGATGAGTGGATACCTATCGAGTCGCTTTGGAGCCAAGGT
GCTGCTGCTGACCATCATGTTGCTCACCGCTCTGCTCAGCATTGCCACGC
CCTTCGCCTTGGCCTGGGGCGGCTGGCAGCTGCTCTTCTGGGTGCGATTC
GTCCAGGGACTCGCCATGGGCGGCATGTGGCCCTGCCTGTACACCCATCT
GGCCAAGTGGTGTCCCAAGAAGGAGGCCAATCGCATGGGCGGCATCATGA
CCACTGGCTTGGATTGTGGGACAATAATGGGATTCGCTTTGAGTGGCGTA
CTCTCTGCATCGCCCCTCGGGTGGCCCAGCACATTCTACGTGCCAGGATA
CTTAGGCATCGTGTGGTGCCTTACTTTCTTGCGATATGGCGCCAACAGCC
CATCCGAATCGAAATTCATTTCTCTGGCGGAACGAAAGCACATTCAATTT
GCCCTCGAGCAGAATCAGGTGATTCGCGGTGCAACTCCTCCAGTACCGTG
GCTCCAGATCCTCACCTCTCGTCCATTTATCGTCCTGGCGTTTTGCAAAA
TGAGCCAGGCGTGCAGCTTCTACACGCTGATGCAACAGATTCCGCGCTAC
ATCCACGGTATATTCCACTACAGCATTGCGGCAAATGCCCTGCTCTCAGC
TCTGCCCTTTGTGGTCATGCTGATGTCATCCTACGGATTCATTTTCCTGG
CTGAATACCTAACCCGTCGTCGAGACATTTCATTGCCTATCCTACGGAAG
ACCATTAATTCCTTTGCCACATGGACCCCTGCTGTAGCCCTGGTTATCCT
ATCCTACGTCAGCGATCAGAATGTGGTGGGCAGTATGTTTTGTCTGATTG
CAGCCACAGCTGCCATTTCCGGACAGGCCATTGGCAGTTCCCTTAACCAC
GTGGACTTGTCGCCAAACTTTGCTGGACTCCTGTTTGGGATGAGCAACAC
ACTGATGTCTGCGGCTGGTGTGATATCGCCAATCGTCATTGGGCTGACCG
TAACCAAAGAGTCGGATCGATCGCAATGGCGAACAGTTTTCCTTGGCATT
TCGGTGATTCTGTTCCTCGGCAACTTGATGTACCTAATCTTTGGTCAAAT
GACCGTCCAGTCCTGGAATGATTCCCCATCCAAAGAGACCGAAACAGAAG
CATCACCAAAGCCCCAGGCATCGGCTCCCTCAGTTGCCGAGGAAACGATA
TCCGTCGAGAGATTTAACTATTTGGCAAGCTTTCTAGACCAT

BO27485.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG3649-RB 1461 CG3649-PB 1..1458 17..1474 7290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG3649-RB 1569 CG3649-RB 41..1498 17..1474 7290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22846910..22847577 594..1261 3340 100 Plus
2R 25286936 2R 22846112..22846659 50..597 2740 100 Plus
2R 25286936 2R 22847626..22847840 1260..1474 1075 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:41:17 has no hits.

BO27485.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:51 Download gff for BO27485.complete
Subject Subject Range Query Range Percent Splice Strand
CG3649-RA 1..1419 56..1476 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:43 Download gff for BO27485.complete
Subject Subject Range Query Range Percent Splice Strand
CG3649-RB 41..1498 17..1476 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:26 Download gff for BO27485.complete
Subject Subject Range Query Range Percent Splice Strand
CG3649-RB 41..1498 17..1476 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:26 Download gff for BO27485.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22847628..22847840 1262..1476 99   Plus
2R 22846913..22847577 597..1261 100 -> Plus
2R 22846113..22846658 51..596 100 -> Plus
2R 22846017..22846050 17..50 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:43 Download gff for BO27485.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18735151..18735363 1262..1476 99   Plus
arm_2R 18734436..18735100 597..1261 100 -> Plus
arm_2R 18733636..18734181 51..596 100 -> Plus
arm_2R 18733540..18733573 17..50 100 -> Plus

BO27485.pep Sequence

Translation from 16 to 1492

> BO27485.pep
MTIKSFNLVVKGPMWGVRHLQVLFLFLCATLIVAQRFNMSVAIVAFTNAN
SSNPNYPEYRLTEPQKSYTISSPFWGSCCTQMMSGYLSSRFGAKVLLLTI
MLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGMWPCLYTHLAKWCP
KKEANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGYLGIVW
CLTFLRYGANSPSESKFISLAERKHIQFALEQNQVIRGATPPVPWLQILT
SRPFIVLAFCKMSQACSFYTLMQQIPRYIHGIFHYSIAANALLSALPFVV
MLMSSYGFIFLAEYLTRRRDISLPILRKTINSFATWTPAVALVILSYVSD
QNVVGSMFCLIAATAAISGQAIGSSLNHVDLSPNFAGLLFGMSNTLMSAA
GVISPIVIGLTVTKESDRSQWRTVFLGISVILFLGNLMYLIFGQMTVQSW
NDSPSKETETEASPKPQASAPSVAEETISVERFNYLASFLDH

BO27485.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG3649-PB 486 CG3649-PB 1..486 1..486 2525 100 Plus
CG9826-PC 495 CG9826-PC 7..472 11..474 996 40.8 Plus
CG9826-PA 495 CG9826-PA 7..472 11..474 996 40.8 Plus
CG9825-PA 485 CG9825-PA 7..481 11..484 949 38.7 Plus
CG30272-PA 497 CG30272-PA 8..455 12..454 943 39.2 Plus