Clone BO27488 Report

Search the DGRC for BO27488

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:274
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptPGRP-SB2-RA
Protein status:BO27488.pep: Imported from assembly
Sequenced Size:580

Clone Sequence Records

BO27488.complete Sequence

580 bp assembled on 2010-08-18

GenBank Submission: KX799369

> BO27488.complete
GAAGTTATCAGTCGACATGAAGCTACAGTTGGCTCTCGTTCTATGTGGAT
TGACTCTGGCCTTGGGCCAGATTGTTCCCCGCAGCTCCTGGTGTCCTGTG
CCCATCTCGCCGCGAATGCCCAGGCTCATGGTACCGGTGCGACTGATTAT
CATCCATCATACAGTCACGGCCCCTTGCTTCAATCCGCATCAGTGCCAGT
TGGTACTTAGGCAAATTCGAGCCGATCATATGCGCAGAAAGTTCAGGGAT
ATTGGCTATAATTTCCTGATCGGCGGGGATGGTCGAATCTACGAGGGCTT
GGGTTTCGGCATCCGTGGCGAGCATGCTCCCCGCTATAACAGCCAGTCCA
TTGGCATTGCTTTCATTGGCAACTTCCAGACTGGATTACCTCCTTCGCAG
ATGCTCCAGGCTGCCCGAACCCTCATCCAAATCGCTGTGCAGCGTCGCCA
GGTTTCGCCCAACTATTCCGTGGTGGGTCATTGCCAAACGAAGGCCACTG
CTTGTCCGGGAATACACCTTCTCAACGAGCTCAAAAAGTGGCCAAATTGG
CGACCAAAGCCTGCAAGCTTTCTAGACCAT

BO27488.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB2-RA 549 CG9697-PA 1..546 17..562 2730 100 Plus
PGRP-SB2-RB 576 CG9697-PB 1..526 17..562 2395 96.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB2-RA 688 CG9697-RA 6..553 15..562 2740 100 Plus
PGRP-SB2-RB 668 CG9697-RB 6..533 15..562 2405 96.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16726546..16726911 15..380 1830 100 Plus
3L 28110227 3L 16726972..16727153 381..562 910 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:41:23 has no hits.

BO27488.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:52 Download gff for BO27488.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB2-RA 8..553 17..564 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:46 Download gff for BO27488.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB2-RA 8..553 17..564 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:27 Download gff for BO27488.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB2-RA 8..553 17..564 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:27 Download gff for BO27488.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16726972..16727153 381..564 98   Plus
3L 16726548..16726911 17..380 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:46 Download gff for BO27488.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16720072..16720253 381..564 98   Plus
arm_3L 16719648..16720011 17..380 100 -> Plus

BO27488.pep Sequence

Translation from 16 to 580

> BO27488.pep
MKLQLALVLCGLTLALGQIVPRSSWCPVPISPRMPRLMVPVRLIIIHHTV
TAPCFNPHQCQLVLRQIRADHMRRKFRDIGYNFLIGGDGRIYEGLGFGIR
GEHAPRYNSQSIGIAFIGNFQTGLPPSQMLQAARTLIQIAVQRRQVSPNY
SVVGHCQTKATACPGIHLLNELKKWPNWRPKPASFLDH

BO27488.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB2-PA 182 CG9697-PA 1..182 1..182 979 100 Plus
PGRP-SB2-PB 191 CG9697-PB 1..191 1..180 648 70.8 Plus
PGRP-SB1-PA 190 CG9681-PA 12..188 6..179 456 52 Plus
PGRP-SA-PB 203 CG11709-PB 60..203 40..182 344 44.4 Plus
PGRP-SA-PA 203 CG11709-PA 60..203 40..182 344 44.4 Plus