Clone BO27503 Report

Search the DGRC for BO27503

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:3
Vector:pDNR-Dual
Associated Gene/Transcript5-HT2-RD
Protein status:BO27503.pep: Imported from assembly
Sequenced Size:1948

Clone Sequence Records

BO27503.complete Sequence

1948 bp assembled on 2010-09-13

GenBank Submission: KX800016

> BO27503.complete
GAAGTTATCAGTCGACATGGAGATGCAAAGCTACTCTGGTCGTGGACCAT
CGACAGGCACATCAGAAACAGCAACAGCAACAGCAGCAGTTGCATCTGCA
TCTGCATCAGACACAGCAGCAACATTCACACTGCGACACTTCAATTGTCG
GCTGGAAGAGGCGGATTGGCCTGGGCCTCGCCAGCCGTTTATTGACTGCG
AAGGCAGCCACACCAACAGCACATCCTACACCCCCAGCAGCCTGCCCACC
AGCAAAAACCTCATCGAGGGACCCAACAACACATTCCAGTGTGCACGGCA
AGCTATCGACGAAGCGGAGCACAACGCATTCTATAGTTGCGATGGGGAAA
GCCCATTGTCTGAAAACTGCACTTTGAGGCTGAAGGCGCGACTGTTGCGA
TGGCCGTACGAGGCGTATGAGCACATTCGACTGGCAATCAACGGGGCACT
CAGTGATTATGCTAGTGATAAACTTAGTGATAGTTCGAGCTGCGATGAAG
GAGGCATGGTGTTGCAATGTAAGCTGGGCCAGGCCCATGAACTATTGCTT
TGTCATTTGCAACAACTCGAGAGGGAGCCACTGCGGGAGGTGGGAAGCGC
GGAGGAGAGCTTCTCCAACGACAGCCTTCTGCAGGCCTTTCAAATCGAAC
TGGGCGCAGAGCGCGATGGACTCTGGTCCTTCCTTAATCTAAGCGAGCTA
ATGGAGCCCGATCACGGATTCCTGGGCATCATGAATGTCACCAACACTAG
CTTAGACATGTTTTTGCCGAACCTTACAGCCCTGAACACGACCTCCACGG
CCTCCACTGCAGACATGGCCACCGAGTTCGCGGTAACAAAGAGCTTTCTG
GACTACAGTCCCCACGGCTACGATTTCCTATTCCTGTTCGTGGTGTTCTT
TATCTTCGCGGGTGGCCTGGGTAATATCCTTGTGTGCCTAGCCGTTGCCT
TGGACCGGAAACTGCAGAATGTGACTAACTACTTCCTGTTTTCCCTGGCT
ATAGCCGATCTCCTGGTCAGTTTGTTTGTGATGCCCATGGGCGCGATACC
AGCTTTTTTGGGGTATTGGCCACTTGGCTTTACCTGGTGCAACATTTATG
TGACGTGTGACGTACTGGCCTGCTCATCCAGTATATTGCACATGTGCTTC
ATCAGTTTGGGACGCTATATGGGAATAAGAAATCCATTGGGCTCGAGGCA
TCGATCTACGAAACGATTGACTGGTATAAAGATAGCCATTGTTTGGGTAA
TGGCCATGATGGTATCCAGTTCAATAACCGTTCTTGGTCTGGTCAATGAG
AAGAACATAATGCCCGAGCCTAACATATGCGTTATCAACAATCGCGCCTT
TTTCGTGTTTGGATCTCTGGTAGCTTTTTATATACCCATGCTGATGATGG
TTACCACATACGCATTGACGATTCCCCTCCTCCGGAAGAAAGCGCGATTT
GCCGCCGAGCACCCGGAAAGTGAACTTTTTCGCAGGTTGGGTGGACGCTT
CACCCTAAGGCCGCAGCACAGCCAGCAGCAGTTGCAGATGTTCAGTAGCT
TTTCTGGCAGCAATAACAAATTCCTATCAATGGGCGACGGCAATCGCAAC
TTCAACACTGAAGGAGAGATGGAGGAGGGTGGAGCTCCTAGCAGAAGGAG
TGGCGTAGAGCCCGCCGAACGACCTTTGATGCAACAGCGAACGGCGAGCA
GCAGGAGCATGGGCACGGTTAGTTTCCGTAATGTCGTGAACGGGACTAGC
GGAGCCGCAGGAAGTGGGCGCAGGACGACTGGCACTGCCCACAGCAGCTT
CCGGTTCTCTGGCGCCGGCATCTTTCGGCACTCGTCGTCGTCTCCCGCCT
CGAGCTGCCACTCCACCAGCACGTCGCGTTCGAGCTCCTTCTGGCGCAAA
CACGGCGGCTATCCAAACCTAATGGACAGGGCAAGCTTTCTAGACCAT

BO27503.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
5-HT2A-RD 1917 CG1056-PD 1..1914 17..1930 9570 100 Plus
5-HT2A-RH 2754 CG1056-PH 1..1913 17..1929 9565 100 Plus
5-HT2A-RF 2751 CG1056-PF 1..1913 17..1929 9565 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
5-HT2A-RD 3178 CG1056-RD 553..2466 17..1930 9570 100 Plus
5-HT2A-RH 3683 CG1056-RH 553..2465 17..1929 9565 100 Plus
5-HT2A-RF 3541 CG1056-RF 414..2326 17..1929 9565 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4622580..4623625 17..1062 5230 100 Plus
3R 32079331 3R 4627903..4628350 1483..1930 2240 100 Plus
3R 32079331 3R 4626965..4627199 1054..1288 1145 99.1 Plus
3R 32079331 3R 4627258..4627459 1286..1487 1010 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:14:04 has no hits.

BO27503.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:19 Download gff for BO27503.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2-RD 548..2461 17..1932 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:14 Download gff for BO27503.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2-RD 553..2466 17..1932 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:13:44 Download gff for BO27503.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2A-RD 553..2466 17..1932 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:13:44 Download gff for BO27503.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4627906..4628350 1486..1932 99   Plus
3R 4627259..4627457 1287..1485 100 -> Plus
3R 4626973..4627197 1062..1286 100 -> Plus
3R 4622580..4623624 17..1061 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:14 Download gff for BO27503.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 453628..454072 1486..1932 99   Plus
arm_3R 452981..453179 1287..1485 100 -> Plus
arm_3R 452695..452919 1062..1286 100 -> Plus
arm_3R 448302..449346 17..1061 100 -> Plus

BO27503.pep Sequence

Translation from 16 to 1948

> BO27503.pep
MEMQSYSGRGPSTGTSETATATAAVASASASDTAATFTLRHFNCRLEEAD
WPGPRQPFIDCEGSHTNSTSYTPSSLPTSKNLIEGPNNTFQCARQAIDEA
EHNAFYSCDGESPLSENCTLRLKARLLRWPYEAYEHIRLAINGALSDYAS
DKLSDSSSCDEGGMVLQCKLGQAHELLLCHLQQLEREPLREVGSAEESFS
NDSLLQAFQIELGAERDGLWSFLNLSELMEPDHGFLGIMNVTNTSLDMFL
PNLTALNTTSTASTADMATEFAVTKSFLDYSPHGYDFLFLFVVFFIFAGG
LGNILVCLAVALDRKLQNVTNYFLFSLAIADLLVSLFVMPMGAIPAFLGY
WPLGFTWCNIYVTCDVLACSSSILHMCFISLGRYMGIRNPLGSRHRSTKR
LTGIKIAIVWVMAMMVSSSITVLGLVNEKNIMPEPNICVINNRAFFVFGS
LVAFYIPMLMMVTTYALTIPLLRKKARFAAEHPESELFRRLGGRFTLRPQ
HSQQQLQMFSSFSGSNNKFLSMGDGNRNFNTEGEMEEGGAPSRRSGVEPA
ERPLMQQRTASSRSMGTVSFRNVVNGTSGAAGSGRRTTGTAHSSFRFSGA
GIFRHSSSSPASSCHSTSTSRSSSFWRKHGGYPNLMDRASFLDH

BO27503.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
5-HT2A-PD 638 CG1056-PD 1..638 1..638 3322 100 Plus
5-HT2A-PB 930 CG1056-PB 1..638 1..638 3322 100 Plus
5-HT2A-PA 868 CG1056-PA 1..638 1..638 3322 100 Plus
5-HT2A-PH 917 CG1056-PH 1..637 1..637 3317 100 Plus
5-HT2A-PF 916 CG1056-PF 1..637 1..637 3317 100 Plus