Clone BO27509 Report

Search the DGRC for BO27509

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptCG15067-RA
Protein status:BO27509.pep: Imported from assembly
Sequenced Size:496

Clone Sequence Records

BO27509.complete Sequence

496 bp assembled on 2010-08-18

GenBank Submission: KX796351

> BO27509.complete
GAAGTTATCAGTCGACATGAAGAGCCTGACGTTATTGGCGCTTTTGATCT
TGGCCACGTTGGCCTTTGTCCACGGTGGCAAGGTGACCATCAACGGCAAG
TGCGTAAACTGCTCCCATGATCAAACGACTACCACCACGCACAAGCCAAC
AAGTGGAAAAGGAAGTGGAGGTAGGACGACAGCCCGGCCAAGCTCGAGAT
CATCTCCAGCCCGCGGTCGCCCATCATGGGATGACGATGATGATGATGAC
CTGACCGGTGACTGGGCACTGCATCAATCGGCTGGAGGAACTCAATACAT
TGGCAGGCGTTCGAAGCGTCAGTCACGCGGTGGTCAGTACATCGATTTGG
GCGGATCTGGCGGAAGGGGTGGAGGCGGAGGATGGGCAGGATCTGGCATA
ACCACCATCGATTCCAGTGGCTATCCCGGCGGAACACTGGTGCGCAATAG
TGATTGCGTCGGTTGCAATATTCGCGGAGCAAGCTTTCTAGACCAT

BO27509.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG15067-RB 465 CG15067-PB 1..462 17..478 2310 100 Plus
CG15067-RA 465 CG15067-PA 1..462 17..478 2310 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG15067-RB 505 CG15067-RB 19..480 17..478 2310 100 Plus
CG15067-RA 711 CG15067-RA 19..480 17..478 2310 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18385055..18385459 478..74 2025 100 Minus
2R 25286936 2R 18385512..18385571 76..17 300 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:49:29 has no hits.

BO27509.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:57:16 Download gff for BO27509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15067-RA 18..479 17..480 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:33:35 Download gff for BO27509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15067-RA 19..480 17..480 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:27:22 Download gff for BO27509.complete
Subject Subject Range Query Range Percent Splice Strand
CG15067-RA 19..480 17..480 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:27:22 Download gff for BO27509.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18385514..18385571 17..74 100   Minus
2R 18385053..18385458 75..480 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:33:35 Download gff for BO27509.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14273019..14273076 17..74 100   Minus
arm_2R 14272558..14272963 75..480 99 <- Minus

BO27509.pep Sequence

Translation from 16 to 496

> BO27509.pep
MKSLTLLALLILATLAFVHGGKVTINGKCVNCSHDQTTTTTHKPTSGKGS
GGRTTARPSSRSSPARGRPSWDDDDDDDLTGDWALHQSAGGTQYIGRRSK
RQSRGGQYIDLGGSGGRGGGGGWAGSGITTIDSSGYPGGTLVRNSDCVGC
NIRGASFLDH

BO27509.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG15067-PB 154 CG15067-PB 1..154 1..154 831 100 Plus
CG15067-PA 154 CG15067-PA 1..154 1..154 831 100 Plus