Clone BO27514 Report

Search the DGRC for BO27514

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptCG32544-RA
Protein status:BO27514.pep: Imported from assembly
Sequenced Size:592

Clone Sequence Records

BO27514.complete Sequence

592 bp assembled on 2010-08-18

GenBank Submission: KX795244

> BO27514.complete
GAAGTTATCAGTCGACATGTCGTCGGAGCAGCCGGAGAACACCAGCTACG
AGCAGGAATGCCAACGGGCGGAGCTGCTGGGCCTCCAGCCACCGGATCCC
GCGGAGTTCGAGCGCAAACGGCAGGCACGACTGGAGCACGAGTTGGCCGA
GCAAGAGGCCGCCGAGGCGGTGCTGCTGGAGCAACAAGACGAGAGTCTGG
GCAATGTGGGCGGCAAGCTGGGCGAGCTCAATAGCATCCTGTCCAGCACG
CAGCAGAAGCTGAATCGCTTCAAGCAAACGGCATGTGGCAGTTTGACCAA
CATATTTGCCCGGGCCAGCTCGGGCTCGGTGGATCTTTCGGCGGGCATTG
GTAGATCGGGCTCAATCGCCTCCACACAGGAGGAGCGTCCTCCTGTCCAG
GAACAGCCACTGGCCAAGCCTCCGCCGACGGCTGCCGAGGTCAGCGCCGC
CAAGGCGGCCAAGCAGAAGCGCATGGACTCGCAGCTGGACAAGCTGGATG
CGCTGATCAACCAGGCGGACAACGCTCAGATAGCCATGAGTGAGCAGACA
CAGCAGATGCGCCGCCTGGCCAAGGCAAGCTTTCTAGACCAT

BO27514.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG32544-RB 561 CG32544-PB 1..558 17..574 2775 99.8 Plus
CG32544-RA 561 CG32544-PA 1..558 17..574 2775 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG32544-RB 1527 CG32544-RB 30..588 16..574 2780 99.8 Plus
CG32544-RA 1630 CG32544-RA 30..588 16..574 2780 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18860520..18860922 172..574 2000 99.8 Plus
X 23542271 X 18860313..18860469 16..172 785 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:47:50 has no hits.

BO27514.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:57:10 Download gff for BO27514.complete
Subject Subject Range Query Range Percent Splice Strand
CG32544-RA 31..588 17..576 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:33:09 Download gff for BO27514.complete
Subject Subject Range Query Range Percent Splice Strand
CG32544-RA 31..588 17..576 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:26:43 Download gff for BO27514.complete
Subject Subject Range Query Range Percent Splice Strand
CG32544-RA 31..588 17..576 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:26:43 Download gff for BO27514.complete
Subject Subject Range Query Range Percent Splice Strand
X 18860521..18860922 173..576 99   Plus
X 18860314..18860469 17..172 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:33:09 Download gff for BO27514.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18754554..18754955 173..576 99   Plus
arm_X 18754347..18754502 17..172 100 -> Plus

BO27514.pep Sequence

Translation from 16 to 592

> BO27514.pep
MSSEQPENTSYEQECQRAELLGLQPPDPAEFERKRQARLEHELAEQEAAE
AVLLEQQDESLGNVGGKLGELNSILSSTQQKLNRFKQTACGSLTNIFARA
SSGSVDLSAGIGRSGSIASTQEERPPVQEQPLAKPPPTAAEVSAAKAAKQ
KRMDSQLDKLDALINQADNAQIAMSEQTQQMRRLAKASFLDH

BO27514.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG32544-PB 186 CG32544-PB 1..186 1..186 918 100 Plus
CG32544-PA 186 CG32544-PA 1..186 1..186 918 100 Plus