Clone BO27519 Report

Search the DGRC for BO27519

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptCG5290-RA
Protein status:BO27519.pep: Imported from assembly
Sequenced Size:2428

Clone Sequence Records

BO27519.complete Sequence

2428 bp assembled on 2010-10-15

GenBank Submission: KX794781

> BO27519.complete
GAAGTTATCAGTCGACATGGTTGCCGATATATTCAGTGAATATTATATAT
GCAATTTCAACGATGCGGTGACAGTTGAAGATCTGCCCGCGGATGAGACA
CTGCGTCAATTGTGGACCCGCCAGAAACTGTGGACAATAGATGAACTCCG
GGAGATCCTTCAACGCTGGCAGGAGCATGTCAAGCCAGATCCGAATGATA
ATCCCACCTCACAACTCAAGGATTTCCTGCTGCTGATATTCGCTTTTGTT
CAAAACAGTTTTACTGGGCCCTTTGACAAACTCGAAGAGTACCAACAAAT
CCATAGTGAACTAGAGCTGGAGAAACTCGACGCACTCGAGAAACTGAAGG
CCAGCGGCGAGGAACTGAATCCAAATGTAAAATCTGTAGAACTACTACTG
ATTGCCAGGGAAATCCTTGAGGGACTTTTAGAAAACCATCCAGAATCAAA
GGTCCTGATTTGGTGGCGATTGCGTCTGATCTGCCTGCATCAACATGTGC
TGGATGATTTGGCGGCCTCCCTGTATGAGCAGTTTAAGTCAGCAGCTGGA
CATCTTCAGGCTCATTTCAATCAGTTTGAGAGCAGGGAACTGCAATCCCT
GCTACTACTGGAGTTGGCCAATGGCTACCTGCAGTTTCATCGCTCTGAAA
TAGCCTCCCAAATACTGGATGAACTGTGCAAGCATCTCCAGGTGGAGCTA
AAAGTTGAGGGTTTACTAGGAGTACGCACCAAATTCCAGCAGAAGGCCCT
GCCACAACTCTGCCTCAAAGTTGAGCATCTAAACGAGCAGCAGCCTCTGC
CTCCAGCCGTCCAAACAAATGAGACGACCAAATTGCCAAAACTGCTTCTT
CTGGAGGATGACACGCGACTGGAGCGGATACGCTTTGTGGAACTGAAGGA
CAACGAAGTGATGACGCTTCCCAGTGTTCTCCAAGCTCTGGTGCTGGCCA
AAGTAAAGCAATTGAAACGCTCAACGCCTAAGGATCGCCTGGCGGATGAA
CAACTGGAGCCGTATACACAAACCCTACTTTACCAGGAACACGGACCATT
CCAAGTCCGGCAGTCAGCCCTTCTTCTAAACTGCCTTCAGGAATCGAATC
AAAGAAGGACAGTCGAACGCAGCTGGAAACAATGCGAGGAGTGTGTCAAA
CTGCTTGACACCTCCGAGGAGGAGCTATCGCTGCGATCCCGACTCTCCTA
CGGTTTCGCCGCCCACTTGAGTCCCAAGTGGCAGGTGCAGCTACAGCTTG
TCGACTTGCTGCGATCCTTGGGCATGACCAAAACAGCTCTGGACATCTGT
CTTCGCATACACGCCTGGCAGCAGGTGATCGAGTGCTACACGAGTCTGGA
ACTCCGTCACAAGGCAGCGGAGATCATCAGGCAGGAACTGGAGAAGAAGC
CAACGGCATTGCTGTACTGCCTCCTTGGCGATGCTATCGATGATCCTTCG
TTCTATGAGCAGGCTTGGTTGTATTCCAAAAAGACAAGTGGAAAAGCTCA
AGCCTATTGGGGCAACCATTTCTATAGGAGTGCGGATTATGCCCAGGCAA
TGGATCACTTCGAGATTTCGCTAGAGATTAACAACTTGCAGGAAGCGATT
CTTTTGCGCTGTGGCTACTGTGCAATCCAACTGGAACGCTGGGAGCCGGC
TGTTAAATATTATTTGGCTTACACCCACCTGGAACCCAATGGATTCGAAT
CCTGGAATAACCTAGCCAAGGCCCTGATTAAATTGGGTGACAAACAGCGG
GCCCATCGTGTTCTTGGTGAGGCCTTGAAGTGCAACTACAGCAACTGGAA
GGTTTGGGAGAACTACATGCTGGTGTCCGTGGATACTTCCCACTGGGACG
ACGCCATGCGGGCTTACCAGCGCATGGCGGAGCTAAAGCAGCACTACCTC
GATCAGGAAGTGCTAACCCGTATTGTTTACGGAGTTTCCAAGGAGGACCC
CGCCGGCTCAAGTGCTCTGATCAAAAGACTCATAAAGCTTCTGGGACAGC
AGAGCATTCAACATGGTAACGAGCCTCTTGTGTGGGAACTGGCCGCCTTG
GTGGCCCAAACGCCACTGAAGAAGGCCGAGAAACTGGTAAAATCGTATCG
TGCGTACACACCGAAGCATTTGGGCTGGGAAACCAAGTCGGAGCACGCTT
TAAAAGCCCTAGATCTTTGTTTAGAGGTCTGCGATCTCTCAGTGGCGGCC
ATCACAGAGCACATTCAAGAGGAAAGTGAGGTAATGATTACCTCTCAACT
AAATTCAGCCAGACTGGCGGGAACATCTTGTCTGAATGCTTTGAAGAGAG
CCATAAATGTGGATGTATCGGCAGAACAGACTGCAAAAGTGGAGCAGCTG
GAAAAACGCATCGAAGACCTGACAAAAATTGTCCAGGAACGAATGAATGC
GTCTCGATCTGCAAGCTTTCTAGACCAT

BO27519.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5290-RA 2397 CG5290-PA 1..2394 17..2410 11970 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5290-RA 2917 CG5290-RA 255..2648 17..2410 11970 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17909752..17911207 2410..955 7280 100 Minus
3L 28110227 3L 17911269..17911773 954..450 2525 100 Minus
3L 28110227 3L 17911824..17912198 453..79 1875 100 Minus
3L 28110227 3L 17912248..17912311 80..17 320 100 Minus
Blast to na_te.dros performed on 2014-11-26 14:59:45 has no hits.

BO27519.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:22:55 Download gff for BO27519.complete
Subject Subject Range Query Range Percent Splice Strand
CG5290-RA 247..2640 17..2412 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:02 Download gff for BO27519.complete
Subject Subject Range Query Range Percent Splice Strand
CG5290-RA 255..2648 17..2412 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:18 Download gff for BO27519.complete
Subject Subject Range Query Range Percent Splice Strand
CG5290-RA 255..2648 17..2412 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:18 Download gff for BO27519.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17912248..17912311 17..80 100   Minus
3L 17911826..17912196 81..451 100 <- Minus
3L 17911269..17911771 452..954 100 <- Minus
3L 17909750..17911207 955..2412 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:02 Download gff for BO27519.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17905348..17905411 17..80 100   Minus
arm_3L 17904926..17905296 81..451 100 <- Minus
arm_3L 17904369..17904871 452..954 100 <- Minus
arm_3L 17902850..17904307 955..2412 99 <- Minus

BO27519.pep Sequence

Translation from 16 to 2428

> BO27519.pep
MVADIFSEYYICNFNDAVTVEDLPADETLRQLWTRQKLWTIDELREILQR
WQEHVKPDPNDNPTSQLKDFLLLIFAFVQNSFTGPFDKLEEYQQIHSELE
LEKLDALEKLKASGEELNPNVKSVELLLIAREILEGLLENHPESKVLIWW
RLRLICLHQHVLDDLAASLYEQFKSAAGHLQAHFNQFESRELQSLLLLEL
ANGYLQFHRSEIASQILDELCKHLQVELKVEGLLGVRTKFQQKALPQLCL
KVEHLNEQQPLPPAVQTNETTKLPKLLLLEDDTRLERIRFVELKDNEVMT
LPSVLQALVLAKVKQLKRSTPKDRLADEQLEPYTQTLLYQEHGPFQVRQS
ALLLNCLQESNQRRTVERSWKQCEECVKLLDTSEEELSLRSRLSYGFAAH
LSPKWQVQLQLVDLLRSLGMTKTALDICLRIHAWQQVIECYTSLELRHKA
AEIIRQELEKKPTALLYCLLGDAIDDPSFYEQAWLYSKKTSGKAQAYWGN
HFYRSADYAQAMDHFEISLEINNLQEAILLRCGYCAIQLERWEPAVKYYL
AYTHLEPNGFESWNNLAKALIKLGDKQRAHRVLGEALKCNYSNWKVWENY
MLVSVDTSHWDDAMRAYQRMAELKQHYLDQEVLTRIVYGVSKEDPAGSSA
LIKRLIKLLGQQSIQHGNEPLVWELAALVAQTPLKKAEKLVKSYRAYTPK
HLGWETKSEHALKALDLCLEVCDLSVAAITEHIQEESEVMITSQLNSARL
AGTSCLNALKRAINVDVSAEQTAKVEQLEKRIEDLTKIVQERMNASRSAS
FLDH

BO27519.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG5290-PA 798 CG5290-PA 1..798 1..798 4122 100 Plus