Clone BO27521 Report

Search the DGRC for BO27521

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptCG13160-RA
Protein status:BO27521.pep: Imported from assembly
Sequenced Size:2656

Clone Sequence Records

BO27521.complete Sequence

2656 bp assembled on 2010-09-13

GenBank Submission: KX793950

> BO27521.complete
GAAGTTATCAGTCGACATGGGAGCCACTAGGAATGGCAAGTCCCTTTCGG
GGTCTGAGAACCTAATAATCGAGGTGGATGAGGACAAGATCCGTTGCAAG
CAGTATTCCTGGTACTTTGCCCCCATCTACCTCCTGTTCTGGGTGGGTCT
CTTCTTCGCCGTCATATATCCACTTTTCCAGGCCTTGCCCACCGGAATCA
AAATCTCCGAGGAGGCGGATAAACCGGGACAATTCGTGGCCGAGAGAGCT
CAGGAAATACTGCTGCAAATAAGTCGATTGGGACCCCGTGTGGTGGGTGA
TGTTGATAATGAAGTCACAGTTGTGAATTTGCTGCTCGCTGAAATCGAAA
AAGTGCGCCAGGTGCTGCGAGACGATGTCTATGAAATGGAGGTGGAGGTG
CAACGGGCATCCGGATCCTACTTGATCAAAGGCCTAACGAATCACTATCA
GGGTGTGCAGAATGTGATCGTTAGACTGAGTACGAAGAGCTCAAATAGCA
CCTCCTACCTTTTGGTCAATAGTCACTACGATACCAAGCCGGGTTCACCT
GGTGCCGGAGATGATGCTGCCATGGTTGTCGTAATGCTGGAGGTACTGCG
TCTGGTCGCCGTTTCAGGGGATCCCTTCCTGCATCCGATTATATTCCTTT
TCAATGGTGCCGAAGAGCAGCCAATGCAGGGATCACATGGTTTCATCACG
CAGCACAGATGGGCTGCCAACTGCAAGGCTCTACTGAACTTGGATTCCGC
TGGCGCTGGTGGACGTGATTTGCTCTTCCAGGGCGGTCCCAATCATCCCT
GGCTGATGGAGCATTACAGAAACAGTGCCCCGCACCCGTTCGCCACCACA
ACGGCCGAGGAGATGTTCGAGGCTGGTATCATACCATCGGATACTGATTT
CCGGATCTTTCGGGACTTTGGAGTTGTGCCAGGCTTGGACATGGCCGGCG
TGTACAATGGATTCGTTTATCACACGAAATTCGATCGCTACGCGGTGATA
AGTCTCGATTCCCTGCAGAATTCCGGCGACAATTTACTGGCCTTGGTATG
GAGTATTTCGAATGCCGAAGAAATGTACGACACAGAGGCACACGCGGCGG
GACATGCAGTATTCTTCGACTTTATTGGACTGTTCTTTGTCCATTACCAG
GAGTCGACTAGCTTGGCCCTGAATCTCTTCTTCTCGTTCGGTGCCATTTT
GCTGGTCTGCATCTCGTTGTGGCGAATGTCCCGGGTTACTGGACAGACTA
TGGGCACCTATGCCGGCGTCTTTGGACTCCTATTCCTGCTAGCCCTAGCT
GGTGCTCTCCTCGCCGTGGCCTTTCCTCTGCTGATGGCCACCTTTTATGA
TTGGGGAAATAGAACGTTGACCTATTTTAGCAACAGTTGGCTGGTCATTG
GGTTGTACATTTGTCCATCGGTTATTGGCCTTGTACTGCCCATGACCCTC
TACTTGACGCATACGAAGTGTAACAAGATCCCCCATACTTATTACTTGCA
TATTGTGGGTCACGCGAACTGTGTCCTTTTGGCCATCTTGTGTTTGGGTG
CAACGGCTCTTAAATACCGTAGTGCCTATCTATTTCTGATCTCTCTCATT
TTCTACGTTGCTGCTCTGATCATTAACCTACTGACCCGTCTCCATTGTCG
CGGTTATCTGTGGTCACTGGTGCTGATTGTTTTCCAGATTATACCCTTCA
TTTACCACGCCTACTTGTTCCACATGTTCATACTTATTCTCATTCCGATG
ACTGGTCGCTTTGGCGTCTCCACCAATCCGGATATACTAATCGGCGCTCT
ATGTGGTTTTGGCACAATTTTGGCGTTATCTTTTGCTGCTCCTTTAATCA
ATGTCTTTCGGCGACCGAACTGCATGCTGGGTGGTCTGGCACTGGTTATG
TTTATTTTCTGCATGATTGCCGTCTCGGATGTCGGATTCCCGTATCGGCC
CAAAACAAATGTCATGCGTGCCGACTTCATGCAAGTGCATCGCAAATTTT
TCGAGTACAATGGTTCCATCAGCCACGAGGATTCTGGCTACTACTTCCAT
CTGGGGGATCGAAACAAAGAGGCACCTCTGCGCGATCACATGAACCTGAC
CAACCTGGTACGCCTGGGCGAGGATTGCGACTCCGAGCTGATGTGCGGTA
TTCCCTGCTACCGATATTGTAGTGCCCGGGAGCATGCACTTTGGCTTGCT
CGAGAGGAGCCCGTGGAACTGCCTTATCCAACGGTCTTGGAGTTCCTTAG
CAAGACAGTTCTGTCCGGTGGCTATCAGGTGCGCTATGAGTTCCGGCTAA
CTGGTCCGCCAAATATGGGTCTGTTCTTCAAGCCACTGGATGGTGTAAAA
CTACTCCGATGGACGTTTGCTCCCGCAATGCTGGATAATCCGGCCACTTA
CAGGCCTCCTCTGGAGGTCATGTTAACCTACGGTATTGATAACACTCCCA
TCGAATTCTTCGTGGAACTTTCTAAGGACGATGGCAACTTCAATGAACCC
GTCTTTGAGATGGGCGTCTCTGGACACTATGTCAGTCCACATGATAAGCG
GGATGCGTTGAGCCTGGAGTTCCTTGCCACACTTCCGGACTTTGCCTTCT
CGATGGAGTGGCCCAGTAGCTACGAACGGCATATATTCGCAAGCTTTCTA
GACCAT

BO27521.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13160-RA 2625 CG13160-PA 1..2622 17..2638 13110 100 Plus
CG13160-RB 2628 CG13160-PB 1..2625 17..2638 13045 99.9 Plus
CG33012-RC 2739 CG33012-PC 547..1539 464..1456 645 71 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13160-RA 2733 CG13160-RA 69..2690 17..2638 13110 100 Plus
CG13160-RB 2736 CG13160-RB 69..2693 17..2638 13045 99.9 Plus
CG33012-RC 2849 CG33012-RC 604..1596 464..1456 645 71 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12371764..12372279 39..554 2580 100 Plus
2R 25286936 2R 12374329..12374821 1981..2473 2465 100 Plus
2R 25286936 2R 12373205..12373590 1086..1471 1930 100 Plus
2R 25286936 2R 12373884..12374070 1652..1838 935 100 Plus
2R 25286936 2R 12373648..12373830 1472..1654 915 100 Plus
2R 25286936 2R 12372332..12372508 551..727 885 100 Plus
2R 25286936 2R 12374874..12375038 2474..2638 825 100 Plus
2R 25286936 2R 12372993..12373151 930..1088 795 100 Plus
2R 25286936 2R 12374123..12374266 1838..1981 720 100 Plus
2R 25286936 2R 12372808..12372931 810..933 620 100 Plus
2R 25286936 2R 12372564..12372648 727..811 425 100 Plus
2R 25286936 2R 12369889..12370008 1850..1969 225 79.2 Plus
2R 25286936 2R 12368340..12368411 737..808 195 84.7 Plus
Blast to na_te.dros performed on 2014-11-28 05:20:13 has no hits.

BO27521.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:53 Download gff for BO27521.complete
Subject Subject Range Query Range Percent Splice Strand
CG13160-RA 67..2688 17..2640 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:04 Download gff for BO27521.complete
Subject Subject Range Query Range Percent Splice Strand
CG13160-RA 69..2690 17..2640 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:08:49 Download gff for BO27521.complete
Subject Subject Range Query Range Percent Splice Strand
CG13160-RA 69..2690 17..2640 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:08:49 Download gff for BO27521.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12374874..12375038 2474..2640 98   Plus
2R 12374330..12374821 1982..2473 100 -> Plus
2R 12374123..12374266 1838..1981 100 -> Plus
2R 12373885..12374069 1653..1837 100 -> Plus
2R 12373648..12373828 1472..1652 100 -> Plus
2R 12373207..12373590 1088..1471 100 -> Plus
2R 12372996..12373150 933..1087 100 -> Plus
2R 12372810..12372930 812..932 100 -> Plus
2R 12372564..12372648 727..811 100 -> Plus
2R 12372333..12372507 552..726 100 -> Plus
2R 12371766..12372276 41..551 100 -> Plus
2R 12371662..12371685 17..40 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:04 Download gff for BO27521.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8262379..8262543 2474..2640 98   Plus
arm_2R 8261835..8262326 1982..2473 100 -> Plus
arm_2R 8261628..8261771 1838..1981 100 -> Plus
arm_2R 8261390..8261574 1653..1837 100 -> Plus
arm_2R 8261153..8261333 1472..1652 100 -> Plus
arm_2R 8260712..8261095 1088..1471 100 -> Plus
arm_2R 8260501..8260655 933..1087 100 -> Plus
arm_2R 8260315..8260435 812..932 100 -> Plus
arm_2R 8260069..8260153 727..811 100 -> Plus
arm_2R 8259838..8260012 552..726 100 -> Plus
arm_2R 8259271..8259781 41..551 100 -> Plus
arm_2R 8259167..8259190 17..40 100 -> Plus

BO27521.pep Sequence

Translation from 16 to 2656

> BO27521.pep
MGATRNGKSLSGSENLIIEVDEDKIRCKQYSWYFAPIYLLFWVGLFFAVI
YPLFQALPTGIKISEEADKPGQFVAERAQEILLQISRLGPRVVGDVDNEV
TVVNLLLAEIEKVRQVLRDDVYEMEVEVQRASGSYLIKGLTNHYQGVQNV
IVRLSTKSSNSTSYLLVNSHYDTKPGSPGAGDDAAMVVVMLEVLRLVAVS
GDPFLHPIIFLFNGAEEQPMQGSHGFITQHRWAANCKALLNLDSAGAGGR
DLLFQGGPNHPWLMEHYRNSAPHPFATTTAEEMFEAGIIPSDTDFRIFRD
FGVVPGLDMAGVYNGFVYHTKFDRYAVISLDSLQNSGDNLLALVWSISNA
EEMYDTEAHAAGHAVFFDFIGLFFVHYQESTSLALNLFFSFGAILLVCIS
LWRMSRVTGQTMGTYAGVFGLLFLLALAGALLAVAFPLLMATFYDWGNRT
LTYFSNSWLVIGLYICPSVIGLVLPMTLYLTHTKCNKIPHTYYLHIVGHA
NCVLLAILCLGATALKYRSAYLFLISLIFYVAALIINLLTRLHCRGYLWS
LVLIVFQIIPFIYHAYLFHMFILILIPMTGRFGVSTNPDILIGALCGFGT
ILALSFAAPLINVFRRPNCMLGGLALVMFIFCMIAVSDVGFPYRPKTNVM
RADFMQVHRKFFEYNGSISHEDSGYYFHLGDRNKEAPLRDHMNLTNLVRL
GEDCDSELMCGIPCYRYCSAREHALWLAREEPVELPYPTVLEFLSKTVLS
GGYQVRYEFRLTGPPNMGLFFKPLDGVKLLRWTFAPAMLDNPATYRPPLE
VMLTYGIDNTPIEFFVELSKDDGNFNEPVFEMGVSGHYVSPHDKRDALSL
EFLATLPDFAFSMEWPSSYERHIFASFLDH

BO27521.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13160-PA 874 CG13160-PA 1..874 1..874 4611 100 Plus
CG13160-PB 875 CG13160-PB 1..875 1..874 4599 99.9 Plus
CG33012-PC 912 CG33012-PC 50..912 17..874 2969 63 Plus
CG30047-PA 879 CG30047-PA 6..879 5..874 2526 52.6 Plus
CG30049-PA 878 CG30049-PA 24..878 22..874 2463 52.5 Plus