Clone BO27522 Report

Search the DGRC for BO27522

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptCdk8-RA
Protein status:BO27522.pep: Imported from assembly
Sequenced Size:1396

Clone Sequence Records

BO27522.complete Sequence

1396 bp assembled on 2010-08-18

GenBank Submission: KX799747

> BO27522.complete
GAAGTTATCAGTCGACATGGACTACGATTTCAAGATGAAAACGCAGATAG
AGCGTACGAAAGTGGAGGACCTATTCAACTACGAGGGCTGTAAGGTGGGA
CGCGGAACATACGGCCACGTCTACAAGGCGAAATGGAAGGAGACAAGCGA
TGGCAAAGAATATGCCTTGAAGCAGATCGACGGCACCGGATTGTCCATGT
CCGCCTGCCGCGAGATCGCATTGCTGCGCGAACTGAAGCATCAGAACGTA
ATTACCCTCATCCGGGTGTTTCTGTCGCACAACGACCGCAAGGTGTTCCT
GTTGATCGACTATGCGGAGCACGACCTGTGGCACATCATTAAGTTCCATC
GGGCTGCTAAGGCCACCAAAAAGCAGGTTGTGGTTCCCCGCGGTATGGTT
AAAAGTCTGCTATATCAGATTCTGGATGGGATTCACTATCTGCACAGTAA
TTGGGTGCTACATCGTGACCTGAAGCCGGCCAACATCCTGGTGATGGGCG
ATGGCAACGAGAGGGGCCGCGTAAAAATCGCCGACATGGGTTTCGCGCGG
CTCTTCAATGCCCCATTGAAACCGCTGGCAGATCTGGATCCCGTGGTGGT
TACCTTTTGGTATCGCGCTCCGGAACTGCTGCTTGGCGCTCGTCACTACA
CCAAGGCTATCGACATCTGGGCTATTGGCTGTATTTTCGCCGAACTACTC
ACTTCGGAGCCCATCTTCCATTGCCGCCAGGAGGACATAAAGACCAGTAA
TCCGTACCATCACGATCAGCTAGACCGCATCTTCAATGTGATGGGCTTTC
CGCAGGACAAGGACTGGGAGGATATCAAGAAGATGCCGGAACATCATACG
CTGACAAAGGACTTTAAACGCTCCACATACTCCACCTGCTCGCTGGCCAA
ATACATGGAAAGGCACAAAATAAAGCCAGACAGCAAGGCCTTTCACCTGC
TGCAGAAGCTGCTGCTAATGGATCCCAACAAGCGCATCACCTCCGAACAG
GCCATGCAGGATCAGTACTTCCAGGAGGAGCCGCAGCCCACGCAGGACGT
GTTCGCCGGCTGCCCCATACCGTATCCCAAGCGTGAATTCCTCACCGACG
ACGACCAGGAAGATAAGTCGGATAATAAGCGACAGCAGCAACAGCAGCAG
CAACAACAGCAGCAACAGCAGCAGCAACAGCAGCAGCAACAACAACAGCA
GCAGCAGCAGCAGCAAATGAACGCTGAGCCGAATGCAAAGAGAGTTCGAT
TGTCCGGAGCTGGTAACCAGCAAGATTTTCACCACCAGCAGCAGCAGCAA
CAGCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAACAGATGATGTTCAA
TCAGCAGCAGAACTTCCAGCGCTTCAACGCAAGCTTTCTAGACCAT

BO27522.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Cdk8-RA 1365 CG10572-PA 1..1362 17..1378 6810 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Cdk8-RA 1529 CG10572-RA 66..1427 17..1378 6810 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9837182..9838414 1378..146 6165 100 Minus
3L 28110227 3L 9838475..9838605 147..17 655 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:48:59 has no hits.

BO27522.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:57:15 Download gff for BO27522.complete
Subject Subject Range Query Range Percent Splice Strand
Cdk8-RA 46..1407 17..1380 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:33:25 Download gff for BO27522.complete
Subject Subject Range Query Range Percent Splice Strand
Cdk8-RA 87..1448 17..1380 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:27:11 Download gff for BO27522.complete
Subject Subject Range Query Range Percent Splice Strand
Cdk8-RA 66..1427 17..1380 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:27:11 Download gff for BO27522.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9838475..9838605 17..147 100   Minus
3L 9837179..9838412 148..1380 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:33:25 Download gff for BO27522.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9831575..9831705 17..147 100   Minus
arm_3L 9830279..9831512 148..1380 99 <- Minus

BO27522.pep Sequence

Translation from 16 to 1396

> BO27522.pep
MDYDFKMKTQIERTKVEDLFNYEGCKVGRGTYGHVYKAKWKETSDGKEYA
LKQIDGTGLSMSACREIALLRELKHQNVITLIRVFLSHNDRKVFLLIDYA
EHDLWHIIKFHRAAKATKKQVVVPRGMVKSLLYQILDGIHYLHSNWVLHR
DLKPANILVMGDGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYR
APELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHD
QLDRIFNVMGFPQDKDWEDIKKMPEHHTLTKDFKRSTYSTCSLAKYMERH
KIKPDSKAFHLLQKLLLMDPNKRITSEQAMQDQYFQEEPQPTQDVFAGCP
IPYPKREFLTDDDQEDKSDNKRQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
MNAEPNAKRVRLSGAGNQQDFHHQQQQQQQQQQQQQQQQQQMMFNQQQNF
QRFNASFLDH

BO27522.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Cdk8-PA 454 CG10572-PA 1..454 1..454 2423 100 Plus
Cdk2-PC 314 CG10498-PC 13..288 26..336 492 36.2 Plus
Cdk2-PB 314 CG10498-PB 13..288 26..336 492 36.2 Plus
Cdk2-PA 314 CG10498-PA 13..288 26..336 492 36.2 Plus
Pitslre-PG 778 CG4268-PG 389..683 26..341 489 35.5 Plus