Clone BO27523 Report

Search the DGRC for BO27523

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:23
Vector:pDNR-Dual
Associated Gene/TranscriptCG15533-RA
Protein status:BO27523.pep: Imported from assembly
Sequenced Size:2110

Clone Sequence Records

BO27523.complete Sequence

2110 bp assembled on 2010-09-13

GenBank Submission: KX799637

> BO27523.complete
GAAGTTATCAGTCGACATGAAAGCAATCGGAATCCTGCTGGCGATCGCCT
TGACCTCCGGGTTCCTGGTGGTCTCCGCCGTAAACTTGCCGGGAGTGCCC
GTGGACTTCGACCTGGACGACCACATCCTGTCCGCCATTGCAGACGACAT
AGCCGAGCGTCTGGCCAGGGAGTACATCACCTTCCTGAAGACCGGAGTGG
AGACGGCGGAGTTCTTGAAGCTCACCAATCAGCTGGCCAAGTCGCACAGT
GAGAAGGATATATTCACCAGGAACATGCCCGATCTAGAGCCCAGGGATAG
CTTCTTTGCGTGCGTGGCCTGTCGCTCGGTGACGCGGGTTTTGATTCGCA
CCATTCGCGAGGAGGACGGCGAGCTCCACGGGGAGAATAGCTCCGTTCTG
ATGAAGGAATTCGCTATGGACGTGTGCCGCCGCTTGAATCTGCAAACGGA
GGAGGTCTGCGAGGGATTGATCGATTCCAACCTGCCCTCCGTGGAGTACA
TCATGAGGAACTCCGAGAGTGATTCCCAGAGCTTCTGCTCCTTGTTCATG
GAGTTTAACTTCTGTAACACCGGTACAAATCAAGATTACAATTGGACCTT
GACTATAGACAATACTGGAGAGGCTTCGGCTGGCCCCAAGTCGGACACTC
CCACCTTTCAGGACTCGGACATCAGGATCTGCCAGTTCTCCGACATTCAC
CATGATCCCTACTACACCCCCGGCAGCCTGGCCACTTGTGCGGAACCCAT
GTGCTGTCAGAGGAACAAGGAGACCACCGAGGGTACGTCGGATGCAGCTG
GATACTGGGGCGACTACCGGGACTGCGATCTGCCTTGGCACGCCTTCGAG
TCAGCATTGGACAACGCGGTGGCCAACTCCAAGTGCGACTTCATTTACCA
GACTGGCGACATAGTGGACCACATGGTGTGGGCCACTTCCGTGGAGAAGA
ACACCATGGTGCTGACCAAGGTCAGTGAGCGGCTAAACGCGGCCTTCGGA
GATGTACCCGTATATCCCTGCATCGGAAACCACGAGCCTCATCCACTCAA
CCTCTTCAGTCCCGAGGGCGTTCCAGATGAGATCAGCACCAAGTGGCTCT
ATGAGCACCTGTACAACGATTGGTCCAAGTGGCTGCCGGCTGAAACCAAG
GAAACCATCCTTAAAGGAGGTTACTACACGGTGGTGCCCAGGAAGGGCTT
CCGTATCATCGCTCTAAACAGCAACGATTGCTATACGGACAACTTCTGGT
TGTATCACAGTGGCACGGACAAGATTCCCCAACTCCAGTGGTTCCACGAT
ACCCTGTTGGAGGCCGAGAAGAACGGGGAGTATGTCCACGTGCTGACCCA
CATTCCTTCGGGCGATGGAACCTGCTGGTCCGTTTGGGCTCGGGAATTCA
ACCGCTGCGTATCCCGCTTCAGGTCCACAATCAGTGGCATTTTCACAGGA
CACTCGCACAAGGACGAGCTATTCGTTTACTACTCGGAGGATGAAGGACA
CCCCACCGCAGTGGCGTGGAACGGAGGTGCTGTTACCACCTACTCCAACA
AGAACCCCAACTACCGAGAGTACGCCGTCAATCCCGAAACTTACACTGTG
ACCAACCACTGGACGTGGATTTACAACCTGACTGCTGCCAATCTGAAGCC
AGATGAACAGCCCGAGTGGTTCCTGGAGTACGAGTTCATCAAGGAGTTCA
CGGAAGATATGAGTCCGGCCGGAATCAGCAAGCTGCTCGATGAGTTCGCC
GAGAATCCCGAATTGATGAGAAAGTACTGGCGCTACCGAGTGACCTCAGC
AGATCCCCAGGTGAATGGAGGTTGTGATCGCAGCTGCTTGGCAGGATCTC
TTTGCCGAGCTGCTGTGACCATCAATTCCGAGCGAGAACGCTGCGAGGAG
CTGCGTGAGAAGTTGTTTGCCTCGCTGGACAATGAGGAGAGCACATCGTC
GTCGGGAAGCACTGAAGCCACCACCCCAAGTCCCAGCACCCCAGGGGGCA
ACGATGACAACGACGGTGGAGGATCCTCCACTTTGGGACTGCTCAGCGTT
AGCTCCCTGCTGGCTATAGTCCTCTCCATCCGCCTAGCCTTGGCAAGCTT
TCTAGACCAT

BO27523.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG15533-RA 2079 CG15533-PA 1..2076 17..2092 10365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15533-RA 2203 CG15533-RA 22..2098 16..2092 10370 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30428841..30429878 16..1053 5175 99.9 Plus
3R 32079331 3R 30430083..30430803 1054..1774 3605 100 Plus
3R 32079331 3R 30431089..30431257 1924..2092 845 100 Plus
3R 32079331 3R 30430877..30431028 1773..1924 760 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:19:17 has no hits.

BO27523.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:50 Download gff for BO27523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15533-RA 17..2092 17..2094 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:00 Download gff for BO27523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15533-RA 23..2098 17..2094 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:08:28 Download gff for BO27523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15533-RA 23..2098 17..2094 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:08:28 Download gff for BO27523.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30431090..30431257 1925..2094 98   Plus
3R 30430879..30431028 1775..1924 100 -> Plus
3R 30430083..30430803 1054..1774 100 -> Plus
3R 30428842..30429878 17..1053 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:00 Download gff for BO27523.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26256812..26256979 1925..2094 98   Plus
arm_3R 26256601..26256750 1775..1924 100 -> Plus
arm_3R 26255805..26256525 1054..1774 100 -> Plus
arm_3R 26254564..26255600 17..1053 99 -> Plus

BO27523.pep Sequence

Translation from 16 to 2110

> BO27523.pep
MKAIGILLAIALTSGFLVVSAVNLPGVPVDFDLDDHILSAIADDIAERLA
REYITFLKTGVETAEFLKLTNQLAKSHSEKDIFTRNMPDLEPRDSFFACV
ACRSVTRVLIRTIREEDGELHGENSSVLMKEFAMDVCRRLNLQTEEVCEG
LIDSNLPSVEYIMRNSESDSQSFCSLFMEFNFCNTGTNQDYNWTLTIDNT
GEASAGPKSDTPTFQDSDIRICQFSDIHHDPYYTPGSLATCAEPMCCQRN
KETTEGTSDAAGYWGDYRDCDLPWHAFESALDNAVANSKCDFIYQTGDIV
DHMVWATSVEKNTMVLTKVSERLNAAFGDVPVYPCIGNHEPHPLNLFSPE
GVPDEISTKWLYEHLYNDWSKWLPAETKETILKGGYYTVVPRKGFRIIAL
NSNDCYTDNFWLYHSGTDKIPQLQWFHDTLLEAEKNGEYVHVLTHIPSGD
GTCWSVWAREFNRCVSRFRSTISGIFTGHSHKDELFVYYSEDEGHPTAVA
WNGGAVTTYSNKNPNYREYAVNPETYTVTNHWTWIYNLTAANLKPDEQPE
WFLEYEFIKEFTEDMSPAGISKLLDEFAENPELMRKYWRYRVTSADPQVN
GGCDRSCLAGSLCRAAVTINSERERCEELREKLFASLDNEESTSSSGSTE
ATTPSPSTPGGNDDNDGGGSSTLGLLSVSSLLAIVLSIRLALASFLDH

BO27523.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:29:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG15533-PA 692 CG15533-PA 1..692 1..692 3728 100 Plus
CG15534-PA 666 CG15534-PA 16..664 16..690 1650 45.8 Plus
CG3376-PA 735 CG3376-PA 158..722 99..660 802 32.2 Plus
CG3376-PC 764 CG3376-PC 187..751 99..660 802 32.2 Plus
CG3376-PB 708 CG3376-PB 158..696 99..645 796 32.7 Plus