Clone BO27524 Report

Search the DGRC for BO27524

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:24
Vector:pDNR-Dual
Associated Gene/Transcriptmthl5-RA
Protein status:BO27524.pep: Imported from assembly
Sequenced Size:1522

Clone Sequence Records

BO27524.complete Sequence

1522 bp assembled on 2010-08-18

GenBank Submission: KX798072

> BO27524.complete
GAAGTTATCAGTCGACATGCTCGTAAAAACGCTTGGCGCGCATTTTGCAG
CCGGGCAAAATGCAAAAAAATGCAGCTGCTGCGCTCTGCTGATTTCCCTG
CTCTGCGTATTACTTCTTAGTCTAAACCCTTTACCAGTAACCAGTCATGT
CACTAGCGCCGGATCATCAACAGCCCTATCTTCCGATCCCAACCTAGTGC
TGGTCAACAAATGTTGCGAGAAGTTCGAGATACACGTGGACCATGAGTGT
CAGCAGGTCAATGAAACGGACTACTTCCAGCCGATGTTCACCAGCTATGG
AGGAGAGCAAAACAGGCCCGTTAAGTTCAAATTCGTCATCGGGATTCCAA
ATTGTGGATCCATGCAGATGTGGCCAATATACCACTATGCTGGCAGCTCT
GATAAGCTAGTGTTACTGGATGATGGGAGGCTAAGGCATTACACCAATGC
CGAAAACGAAGCAGAGGAGCGTCATGGAATACAATCGGATTATGAGGAGG
ATATTGCCGGCAGTCTGGAACCGCTATACCATGACTACGATAAGGGATTG
TATTGCATTGACAAGGCCACTTCCAGTACTGGAGAGGAAAATGTGCTATT
CGCCAACATTTGCTTGGCCCGCAAGGAGATCAAGTGGAGTGACTCAAACT
TTCTGCTCCGCAAAATCTTAAACCCAATTTTCCATGGCATCTCGCTTGTT
ATCCTGCTGGTCATCGCCATCATCTATTTTATACTTCCTACTCTCAGAGA
TCTGGTTGGTAACATTGTGACAACGATAGCCATGTGCCTTATGGTAAGCC
AGGCAGCAGACCTTGTCAGAATTTTCACCGAGCTGACCAGCCATGTGAGC
TTCATTGTGGCGGACATTATCCTGTGCTTCAGCCTCTTGGCAGCTTTCTT
CTGGCTGAACAGTTTCGGTTTTTACATTTGGAAGACCTTTCGTTCGAGGA
ACGTCTTCCTGCGAGTCACGGACGGCAGGAAGTACTGCTATTATTCTGCG
TATGCTTGGGGATGCACAGCAACGATGGCTGCACTGGCTGTCTTCGCACA
TTTCTTCCTCGACGCCGAATCCTACAAACAGGAGCACATGGTGGGCGAGC
AAGAGACGATCGGCTGGCTAGGCATATGCATATTCTTTGCTCCAATTGCT
TGTACCATTTTGGTAAACATATTCTTCTATGTGACCACCAGGAAGTTGAT
TAACCGCAGGACGGTATACGGCCGCATTGCGCACAAATTGAAAGCCAATT
TTATCATGTTCTCGCTGATGCTGTTAGTAATGTCTATAGCCTGGCTATTC
CTCATAATGTCCTGGTTGCAGATGGAAGGCCTGCTTTACGCCCACATCGT
AGTTAACGCCCTGCAGACGCCGCTGTTGCTATACATATGCGTGCTGCGCC
AGCGACATGTGACATTTCTGCTGAAAAAGACCTGCTGCTACAATGAGCCA
CCGTCGGCAAACGACTGGGGCGATGAGCTGCATTATATGAACGGCAACGA
TTACGCAAGCTTTCTAGACCAT

BO27524.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
mthl5-RA 1491 CG6965-PA 1..1488 17..1504 7440 100 Plus
mthl5-RB 1494 CG6965-PB 1..1491 17..1504 7375 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
mthl5-RA 1949 CG6965-RA 334..1821 17..1504 7440 100 Plus
mthl5-RB 1952 CG6965-RB 334..1824 17..1504 7375 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11884383..11884886 1248..745 2520 100 Minus
3R 32079331 3R 11884066..11884321 1504..1249 1280 100 Minus
3R 32079331 3R 11886583..11886835 269..17 1265 100 Minus
3R 32079331 3R 11884942..11885125 747..564 920 100 Minus
3R 32079331 3R 11885180..11885351 566..395 860 100 Minus
3R 32079331 3R 11885415..11885540 394..269 630 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:48:32 has no hits.

BO27524.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:57:14 Download gff for BO27524.complete
Subject Subject Range Query Range Percent Splice Strand
mthl5-RA 331..1818 17..1506 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:33:18 Download gff for BO27524.complete
Subject Subject Range Query Range Percent Splice Strand
mthl5-RA 334..1821 17..1506 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:27:00 Download gff for BO27524.complete
Subject Subject Range Query Range Percent Splice Strand
mthl5-RA 334..1821 17..1506 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:27:00 Download gff for BO27524.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11886583..11886835 17..269 100   Minus
3R 11885415..11885539 270..394 100 <- Minus
3R 11885181..11885351 395..565 100 <- Minus
3R 11884942..11885123 566..747 100 <- Minus
3R 11884383..11884883 748..1248 100 <- Minus
3R 11884063..11884321 1249..1506 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:33:18 Download gff for BO27524.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7712305..7712557 17..269 100   Minus
arm_3R 7711137..7711261 270..394 100 <- Minus
arm_3R 7710903..7711073 395..565 100 <- Minus
arm_3R 7710664..7710845 566..747 100 <- Minus
arm_3R 7710105..7710605 748..1248 100 <- Minus
arm_3R 7709785..7710043 1249..1506 99 <- Minus

BO27524.pep Sequence

Translation from 16 to 1522

> BO27524.pep
MLVKTLGAHFAAGQNAKKCSCCALLISLLCVLLLSLNPLPVTSHVTSAGS
STALSSDPNLVLVNKCCEKFEIHVDHECQQVNETDYFQPMFTSYGGEQNR
PVKFKFVIGIPNCGSMQMWPIYHYAGSSDKLVLLDDGRLRHYTNAENEAE
ERHGIQSDYEEDIAGSLEPLYHDYDKGLYCIDKATSSTGEENVLFANICL
ARKEIKWSDSNFLLRKILNPIFHGISLVILLVIAIIYFILPTLRDLVGNI
VTTIAMCLMVSQAADLVRIFTELTSHVSFIVADIILCFSLLAAFFWLNSF
GFYIWKTFRSRNVFLRVTDGRKYCYYSAYAWGCTATMAALAVFAHFFLDA
ESYKQEHMVGEQETIGWLGICIFFAPIACTILVNIFFYVTTRKLINRRTV
YGRIAHKLKANFIMFSLMLLVMSIAWLFLIMSWLQMEGLLYAHIVVNALQ
TPLLLYICVLRQRHVTFLLKKTCCYNEPPSANDWGDELHYMNGNDYASFL
DH

BO27524.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
mthl5-PA 496 CG6965-PA 1..496 1..496 2630 100 Plus
mthl5-PB 497 CG6965-PB 1..497 1..496 2618 99.8 Plus
mthl2-PB 518 CG17795-PB 185..487 175..471 201 24.5 Plus
mthl15-PC 718 CG31720-PC 346..622 171..434 177 22.1 Plus
mthl10-PB 585 CG17061-PB 246..532 216..473 168 20.8 Plus