Clone BO27527 Report

Search the DGRC for BO27527

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptCG14990-RA
Protein status:BO27527.pep: Imported from assembly
Sequenced Size:1000

Clone Sequence Records

BO27527.complete Sequence

1000 bp assembled on 2010-08-18

GenBank Submission: KX794407

> BO27527.complete
GAAGTTATCAGTCGACATGCTCAAGAACTGGACAATAAATACGTTCCTTT
TGGTTTCGTTTCTTTGTAGTGCGACTGGGCAAAATGAAGGAGGAGCACCT
GGAATATTCAACGGAATGTCATTCACGGAAAATCTTCAACCAGACCCAAA
TCAAGTTTGCGGCATGAGCAATCCAAATGGCTTGGTGGCCAATGTGAAGG
TGCCCAAAGATTACTCCACACCTGGCCAATTTCCATGGGTGGTTGCCCTT
TTCAGTCAGGGAAAATACTTTGGGGCCGGTTCTTTGATTGCCCCAGAAGT
AGTCCTTACAGCGGCTAGCATTGTGGTGGGCAAGACTGATGCGGAAATTG
TGGTGAGAGCAGGCGAATGGAATACGGGACAACGCAGTGAATTCCTACCG
TCGGAGGATCGTCCGGTGGCCAGAGTTGTGCAACACAGGGAGTTTTCGTA
TTTATTGGGAGCCAATAACATTGCCCTTCTGTTCCTAGCCAACCCATTTG
AGTTGAAAAGCCACATCCGAACCATCTGCTTGCCCAGCCAGGGAAGGTCC
TTCGATCAGAAGCGCTGCTTGGTGACCGGATGGGGAAAGGTGGCATTCAA
CGATGAAAATTACTCAAATATCCAAAAGAAAATCGAACTGCCGATGATTA
ACAGGGCGCAGTGCCAGGATCAGTTGAGAAACACCAGATTGGGCGTCTCG
TTTGATCTGCCTGCTAGTCTGATATGCGCCGGCGGCGAGAAGGATGCGGG
AGACTGCCTCGGCGACGGAGGATCCGCTCTATTCTGCCCCATGGAGGCGG
ACCCATCGCGCTATGAGCAGGCTGGCATCGTTAACTGGGGCATCGGCTGT
CAAGAGGAAAACGTTCCAGCAGTCTACACAAATGTTGAAATGTTTCGGGA
TTGGATCTATGAGCACATGGCCCAGAACTCCAACAGTGTTCCATTCGCTG
CTGGTCAGTTACCATCGAACTATAAACAGGAAGCAAGCTTTCTAGACCAT

BO27527.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14990-RA 969 CG14990-PA 1..966 17..982 4830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14990-RA 1072 CG14990-RA 32..998 16..982 4835 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4093383..4094270 95..982 4440 100 Plus
3L 28110227 3L 4093238..4093317 16..95 400 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:46:57 has no hits.

BO27527.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:57:08 Download gff for BO27527.complete
Subject Subject Range Query Range Percent Splice Strand
CG14990-RA 34..999 17..984 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:32:54 Download gff for BO27527.complete
Subject Subject Range Query Range Percent Splice Strand
CG14990-RA 33..998 17..984 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:26:22 Download gff for BO27527.complete
Subject Subject Range Query Range Percent Splice Strand
CG14990-RA 33..998 17..984 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:26:22 Download gff for BO27527.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4093383..4094270 95..984 99   Plus
3L 4093239..4093316 17..94 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:32:54 Download gff for BO27527.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4093383..4094270 95..984 99   Plus
arm_3L 4093239..4093316 17..94 100 -> Plus

BO27527.pep Sequence

Translation from 16 to 1000

> BO27527.pep
MLKNWTINTFLLVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGM
SNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAA
SIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGAN
NIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYS
NIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGD
GGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEH
MAQNSNSVPFAAGQLPSNYKQEASFLDH

BO27527.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG14990-PA 322 CG14990-PA 1..322 1..322 1715 100 Plus
CG18478-PA 294 CG18478-PA 21..287 38..304 720 50.2 Plus
CG31827-PA 294 CG31827-PA 21..287 38..304 720 50.2 Plus
SPH93-PA 494 CG6639-PA 214..486 23..301 703 50 Plus
CG3117-PB 347 CG3117-PB 82..334 51..303 659 47.8 Plus