Clone BO27529 Report

Search the DGRC for BO27529

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptTwdlC-RA
Protein status:BO27529.pep: Imported from assembly
Sequenced Size:1114

Clone Sequence Records

BO27529.complete Sequence

1114 bp assembled on 2010-08-18

GenBank Submission: KX795010

> BO27529.complete
GAAGTTATCAGTCGACATGCGTGTCTCCTCGCTGTTCGTTGTGTGCGTGG
CCTCCCTGGTGGCCACCACTTTGGGTCGTCCTGAGCCCCCATCCCCGTAC
TCCTACCACGGATTGCCTCAGCAGCAGAGCCAGCGGGCTTTGCCACTCAA
TGCTCACCCCGTTCCCCCGCAGATTTACCAGCCTCTGCCCCAGGAGCAGT
CGTTTGCCAACTTTGCACCGCCCCAGCAGACCTACTTGCCACCCCAAATG
CATCTGGATGCCATCGAGCAAGTGGCTCCCACTGCCGCCGCCGCTGAGCC
CCTGAATGCCTACGATGACAGCTACAACATGGCCCACCGCCTGTCCGGAG
TGCAGCATGCCAGTGGCTACAACAATGGCCCCCAGGAGACCAAGGTGCAC
AAGCACATCTACGTCCATGTGCCGCCAAAGGACTTCGAGGAGGAGGATGC
CATCCAGACCCGAGTTCACCACCAGCAGGGACCCAAGCAGAAGCACTACA
AGATCGTGTTCATCAAGGCACCATCTGCTCCGGCTATCCGTCAGCCAGTT
GTGCCACCACCACCCCAGAATGAGGAGAAGACTCTGATCTATGTGCTGCA
CAAGAAGCCCGAGCAGGAGCAAGATATCGTGATCCCGACGCCACCACCCA
CCAAGCCATCGAAGCCAGAGGTTTACTTCATCAAGTACAAGACCAAGAAG
GACGAGGCCCCCGTCTATGGACCCCCACCTGCAGAGATGGAGCCCCGTCA
GGCCACCGCCGAGGATTTCGCTCCATTGGCTGAGGTCGCCGATGTCCTGC
CACCCACCACCCTGGCTCCTGCTCCCGAGCCGGAAGTAGAGCAGCCAGCC
ATTCCCTCCGCGGTCTACGGACCACCCACTGCAGCTGCCTATACTGGTGA
GGAGGTTCAGACCACCTTGTCCGCTCCTGCCAACCAGTATCTGCCCCCTG
CCACCGCTCCCGCCGCCCTGGCCATTGAGGAGCCCTCAATGGCGCCCATC
GTGGTGGAGGAACAGCCCGAGCAGCGACTGGCTCCTTCCCATGTGCCTGC
CACCAGCTACGGTCCTCCCAACCGCTACTTCCTTAAGAAGCTGAAGGCAA
GCTTTCTAGACCAT

BO27529.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlC-RA 1083 CG14254-PA 1..1080 17..1096 5400 100 Plus
TwdlT-RA 861 CG5812-PA 553..689 566..702 370 84.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlC-RA 1396 CG14254-RA 103..1182 17..1096 5400 100 Plus
TwdlT-RA 1607 CG5812-RA 743..879 566..702 370 84.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26995284..26996228 152..1096 4725 100 Plus
3R 32079331 3R 26994934..26995069 17..152 680 100 Plus
3R 32079331 3R 27050140..27050276 566..702 370 84.7 Plus
Blast to na_te.dros performed 2014-11-28 02:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 616..769 872..1031 120 56.8 Plus

BO27529.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:57:07 Download gff for BO27529.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlC-RA 99..1178 17..1098 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:27 Download gff for BO27529.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlC-RA 103..1182 17..1098 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:00 Download gff for BO27529.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlC-RA 103..1182 17..1098 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:00 Download gff for BO27529.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26995285..26996228 153..1098 99   Plus
3R 26994934..26995069 17..152 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:27 Download gff for BO27529.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22821007..22821950 153..1098 99   Plus
arm_3R 22820656..22820791 17..152 100 -> Plus

BO27529.pep Sequence

Translation from 16 to 1114

> BO27529.pep
MRVSSLFVVCVASLVATTLGRPEPPSPYSYHGLPQQQSQRALPLNAHPVP
PQIYQPLPQEQSFANFAPPQQTYLPPQMHLDAIEQVAPTAAAAEPLNAYD
DSYNMAHRLSGVQHASGYNNGPQETKVHKHIYVHVPPKDFEEEDAIQTRV
HHQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQNEEKTLIYVLHKKPEQ
EQDIVIPTPPPTKPSKPEVYFIKYKTKKDEAPVYGPPPAEMEPRQATAED
FAPLAEVADVLPPTTLAPAPEPEVEQPAIPSAVYGPPTAAAYTGEEVQTT
LSAPANQYLPPATAPAALAIEEPSMAPIVVEEQPEQRLAPSHVPATSYGP
PNRYFLKKLKASFLDH

BO27529.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlC-PA 360 CG14254-PA 1..360 1..360 1914 100 Plus
TwdlT-PA 286 CG5812-PA 121..236 117..235 378 62.2 Plus
TwdlE-PA 197 CG14534-PA 24..196 95..288 367 44.2 Plus
TwdlBeta-PA 198 CG8986-PA 23..180 68..239 336 44.9 Plus
TwdlG-PC 278 CG14643-PC 15..250 32..261 232 34.8 Plus