Clone BO27530 Report

Search the DGRC for BO27530

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG1648-RB
Protein status:BO27530.pep: Imported from assembly
Sequenced Size:730

Clone Sequence Records

BO27530.complete Sequence

730 bp assembled on 2010-08-18

GenBank Submission: KX794323

> BO27530.complete
GAAGTTATCAGTCGACATGTTTCCTAGTCGCCAAAACCAAACTTCCTTGA
AGAACTTCGGTGACAAGACCGCCAACCTCTTCAGCAAGAAGAAGGATGAG
GCCGAGAAGCTGGCCAACGAGAAGGCTGCCGAGGCCCAGAAGCTAGCCGA
GGAGCAGGCCAAGAAGGTGGGCCAGTCCGTACAGCAGACCAAGGGCGAGG
CCGAGCAGTTGGCCGCCAGCACGGCCAAGGAAGCCGCTGCTCTAGCCACC
GCGGAGGCTCAGAAGGCTGGACAGGCGATTGACCAGGGTGTGAACCGTGC
CGCCGGAGCCGTCAACCAAGGCAAGCAGGCGGTGGACAACACGGTGGCCC
AGGCGGCGGCCGTGGCCCAGAACTCCAAGCAGGTGGCGGCCAATGTGGCG
GAGGCCTCCCAGCGAGCGGCCGCCAATGCGGTGGACCAGACCAAGAAGGC
GGCCAACGACGCCATCAACAAGAGCGTGAAGGCCGCCGAGAACGTGGCGG
ACCAGAAGCTGAAGCAGGCGGAGGGCGCCATCGATGGGGCACTGAAGCAG
ACCAGTCAAACGGTGGACCAGAAGCTGCAGGAGGCCAACCAGTATGTCGA
CCAGAAGCGCCAGTCCGTCGAGAAGACCGTCCAGGATGCGGCAGGACAGG
CCCAGGAGTCTGCCGGACAGCAGGCCAACGCCCTGTTGGGCAAGCTGCAT
CTGGGTCAGAAGGCAAGCTTTCTAGACCAT

BO27530.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG1648-RB 699 CG1648-PB 1..696 17..712 3450 99.7 Plus
CG1648-RC 693 CG1648-PC 20..690 42..712 3325 99.7 Plus
CG1648-RA 693 CG1648-PA 20..690 42..712 3325 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG1648-RB 884 CG1648-RB 19..722 9..712 3460 99.4 Plus
CG1648-RC 1392 CG1648-RC 215..885 42..712 3325 99.7 Plus
CG1648-RA 1047 CG1648-RA 215..885 42..712 3325 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9811481..9811969 712..224 2415 99.6 Minus
2R 25286936 2R 9812482..9812664 224..42 915 100 Minus
Blast to na_te.dros performed 2014-11-28 02:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 2933..2997 485..549 109 63.1 Plus

BO27530.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:57:03 Download gff for BO27530.complete
Subject Subject Range Query Range Percent Splice Strand
CG1648-RB 33..722 23..714 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:26 Download gff for BO27530.complete
Subject Subject Range Query Range Percent Splice Strand
CG1648-RB 33..722 23..714 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:59 Download gff for BO27530.complete
Subject Subject Range Query Range Percent Splice Strand
CG1648-RB 33..722 23..714 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:59 Download gff for BO27530.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9812724..9812742 23..41 100   Minus
2R 9812482..9812664 42..224 100 <- Minus
2R 9811479..9811968 225..714 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:26 Download gff for BO27530.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5700229..5700247 23..41 100   Minus
arm_2R 5699987..5700169 42..224 100 <- Minus
arm_2R 5698984..5699473 225..714 99 <- Minus

BO27530.pep Sequence

Translation from 16 to 730

> BO27530.pep
MFPSRQNQTSLKNFGDKTANLFSKKKDEAEKLANEKAAEAQKLAEEQAKK
VGQSVQQTKGEAEQLAASTAKEAAALATAEAQKAGQAIDQGVNRAAGAVN
QGKQAVDNTVAQAAAVAQNSKQVAANVAEASQRAAANAVDQTKKAANDAI
NKSVKAAENVADQKLKQAEGAIDGALKQTSQTVDQKLQEANQYVDQKRQS
VEKTVQDAAGQAQESAGQQANALLGKLHLGQKASFLDH

BO27530.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG1648-PB 232 CG1648-PB 1..232 1..232 1113 100 Plus
CG1648-PC 230 CG1648-PC 8..230 10..232 1065 100 Plus
CG1648-PA 230 CG1648-PA 8..230 10..232 1065 100 Plus
CG45076-PH 619 CG45076-PH 311..545 5..220 158 25.1 Plus
CG45076-PA 619 CG45076-PA 311..545 5..220 158 25.1 Plus