Clone BO27533 Report

Search the DGRC for BO27533

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptCG10353-RC
Protein status:BO27533.pep: Imported from assembly
Sequenced Size:2986

Clone Sequence Records

BO27533.complete Sequence

2986 bp assembled on 2010-09-13

GenBank Submission: KX795668

> BO27533.complete
GAAGTTATCAGTCGACATGGACGAGCGGGAGAGTCTGTACTTCGACACCA
TATCGCTGGCGGAATCGGAGGCGGCGGCTGCTGCGGCGGCGCATCGCAAG
TCGATCTCGCAGTCGCGCAACACCATCTACCACTCGGCGGTCGATCTGGC
GGGCGATGAGGGAGGCGGAGGAAGCGGTGGAGGAAGGCTGCGTCTGGGCG
GCGGAGCAGCCGCCGAGCACGCAGCGCTTGCCTGGCAGCCTGGATACCGT
CAGTCCACAGCACTGGAGCACCTCAATGGCGGCGGTGGTGGTGGTGGTGA
TCACACGGATGCCGCTATCGCCGCCCAAATGATTGCCCTGCAAAACGGAC
GAAACCACCTGCCCACCGGGATCGGTGTGACCGGAGATGGAGGACAAGGA
GGTGGTGACGATGAGACATACAGACGCTTCGACGATGGCAAACGGAGCGT
GGACTTTGTGCTGGCTTACAACGGAGAGACGCAGCTGGAGGAGCATCGGC
GCAAATGCGAGATCTTTGAGGCGAATCTGCAGCGAGAGGGCTTGCAGCTG
GAGCACAACAAGGTGCAGCGCGTCCATTTCATCAAGATCCATGCGCCGGC
GGAGGTGCTGTACCGCTATGCGGAAATACTCAAGATTAAGGTGCCGCTCA
AACCGATTCCCGGCCAGGATCAAATCTTCGCCGAATCGGCGCACGAGTTC
AAGACCTGCTTCAGTCGCATGTGCAAAAGTCTCTTCAGCTCCGTCCAATT
GAATACGGCCCTGTTTCCGGAACGCGAACCGCGCATCCATCTGGAGTTCT
CCCGCAACTACCTGGAACTGTACGATACGGAGCACCCGAACTTTCTCGAC
GCCAGCACCCGCTACTCCATCATCAATTTCATTCTCCAGCGCCAGCGTTT
CGTGGAGGGCGAGGAGACGGCCGACAATCTGGGCATCGAGAAGCTCGTCC
AGGATGGCGTATATACCTGCGCCTACACCTTGCATGATAAAGACGATCGC
GATCGGCTGCTAAAGGAGTGGGCCAACATATCCAAGTGGAAGAACCTGCA
ACCACTGGACCAAATTAAAGACTACTTTGGAGCAAAGGTGGCACTCTACT
TTGCCTGGCTGGGATTCTACACGCAAATGCTGATACCCATTAGCGTGTTC
GGCGTGCTCTGTTTTCTGTACGGCTTCATCACGTGGAACAGCGATCCGAT
TAGCCGGGACATTTGCGACGACAATGGAACGATCATGTGTCCACAGTGCG
ACCGCAGCTGCGACTATTGGCGACTGAACGAGACGTGTACCTCCTCCAAG
TTCAACTATCTGATAGACAACAATATGACAGTGGTGTTTGCCTTTTCGAT
GGCCATTTGGGCAGTGGTTTACCTGGAGTTCTGGAAACGCTACTCGGCGG
GCCTGGTGCACCGCTGGGGACTGACTGGTTTTACCCACCACGTGGAGCAC
CCGCGTCCGCAATACTTGGCCAGAATATCGCGCACCAAGAAGCTGGCCGG
AAAAGCATATGAGCAGGACCACACTGGCAAGCGGACCATCTTGGATCCGG
ATGTGCCCTTCTGGAGTTTCAAGTTCCTGCCAAACTTCACCAGCTATAGC
ATTATGGTCTTGTTTATTTGCATATCAGTCATTGCCATAGCGGGCATAAT
CATCTATAGAATGGCACAGCGAGCATCGCACAGCATTTTGGGCAGCGAGA
ATTCCATGACCTTTAAGGTTATGATATTGCCCATGACGGCGGGCATCATT
GACCTTATAGTGATCTCGCTGCTGGACATGGTCTACTCGAATTTGGCTGT
AAAGCTAACCAACTACGAGTACTGTCGCACCCAGACGGAATACGATGAGA
GCCTAACTATCAAAAACTATGTGTTCCAGTTCGTCAATTATTACTCCTCG
CTCTTCTACATTGCCTTCCTCAAGGGCAAGTTCGTCGGCTATCCGGCGAA
GTACAATCGCGTGCTGGGCTTTCGCCAGGAGGAGTGCAATCCTGGCGGCT
GCCTTATGGAGCTCTGCATGCAGTTGGTAATCATTATGGCTGGCAAGCAG
GCGGTCAATGCCATCGTGGAGATGCTTATCCCCTATCTGATGCGCACCTT
CAAGGAGCTGAGCTACCGCCACGGCTGGTACAAGAGCCATCAGGACCAGC
GTCTGGTGCCGTACAACCAGTTCACCGAGGACTACAATCTACTGCCTGCC
GAGAACAACTCGCTCTACGTGGAATACCTCGAAATGGTTGTGCAATTTGG
CTTCATCACACTGTTTAGTCTGGCCTTCCCATTGGCTCCGCTGCTGGCCC
TGCTGAACAATGTGATTGAGGTGCGCCTGGACGCCATCAAAATGCTGCGC
TTCCTGCGACGGCCAGTGGGAATGCGAGCGCGCGACATTGGCGTTTGGCA
CAGCATCATGACCGTCGTCACGCGGATTGCCGTGGCCTCGAGTGCAATGA
TAATCGCATTTAGCACGAACCTCATACCAAAAATCGTGTATGCCGCCTCC
ATGGGTGATCCCGAGCTGAACAACTATCTGAACTTCACGCTGGCCGTGTT
CAACACCAAGGACTTTCAGGTGCAGCCACTGCTCGGTGGCAGTCAGCATG
TGAACGAGACGGTGTGTCGCTACACTGAGTTCCGAAACTCGCCGGAAGAT
CCGCATCCCTATAAACGTCCCATGATATATTGGAAGATACTGACGGGTCG
GCTGGCCTTCATCGTCATCTACCAGAACATTATCACCATGCTGCAGGGCA
TCCTGCGCTGGGCCGTACCGGATGTCTCGGGTCGCCTGCTGAAGCGCATC
AAGCGGGAGAACTTCCTGCTGCGGGAGCACATTATCGAGTACGAGAAACA
GCACGCCATGAAACTGGTGCAGACGGAACTCAATGGCCAACAGAAGTCGG
AAGGTGAACTGCGTCAGCGGAACAACGAAACGGTGATCCGGAATCGCGAC
GAAGCCACCTCGTTCGTGGCAAGCTTTCTAGACCAT

BO27533.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG10353-RK 3003 CG10353-PK 49..3000 17..2968 14745 100 Plus
CG10353-RI 2955 CG10353-PI 1..2952 17..2968 14745 100 Plus
CG10353-RC 2955 CG10353-PC 1..2952 17..2968 14745 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG10353-RK 4482 CG10353-RK 522..3473 17..2968 14745 100 Plus
CG10353-RI 4771 CG10353-RI 811..3762 17..2968 14745 100 Plus
CG10353-RC 4203 CG10353-RC 243..3194 17..2968 14745 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11879671..11880292 2237..1616 3110 100 Minus
X 23542271 X 11881330..11881904 988..414 2860 99.8 Minus
X 23542271 X 11880356..11880926 1615..1045 2855 100 Minus
X 23542271 X 11883188..11883586 415..17 1995 100 Minus
X 23542271 X 11879050..11879331 2725..2444 1410 100 Minus
X 23542271 X 11878746..11878991 2968..2723 1230 100 Minus
X 23542271 X 11879397..11879604 2444..2237 1040 100 Minus
X 23542271 X 11881210..11881265 1044..989 280 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:21:19 has no hits.

BO27533.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:55 Download gff for BO27533.complete
Subject Subject Range Query Range Percent Splice Strand
CG10353-RC 240..3191 17..2970 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:09 Download gff for BO27533.complete
Subject Subject Range Query Range Percent Splice Strand
CG10353-RC 243..3194 17..2970 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:09:16 Download gff for BO27533.complete
Subject Subject Range Query Range Percent Splice Strand
CG10353-RC 243..3194 17..2970 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:09:16 Download gff for BO27533.complete
Subject Subject Range Query Range Percent Splice Strand
X 11883188..11883586 17..415 100   Minus
X 11881330..11881902 416..988 99 <- Minus
X 11881210..11881265 989..1044 100 <- Minus
X 11880356..11880926 1045..1615 100 <- Minus
X 11879671..11880292 1616..2237 100 <- Minus
X 11879398..11879603 2238..2443 100 <- Minus
X 11879050..11879331 2444..2725 100 <- Minus
X 11878744..11878988 2726..2970 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:09 Download gff for BO27533.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11777221..11777619 17..415 100   Minus
arm_X 11775363..11775935 416..988 99 <- Minus
arm_X 11775243..11775298 989..1044 100 <- Minus
arm_X 11774389..11774959 1045..1615 100 <- Minus
arm_X 11773704..11774325 1616..2237 100 <- Minus
arm_X 11773431..11773636 2238..2443 100 <- Minus
arm_X 11773083..11773364 2444..2725 100 <- Minus
arm_X 11772777..11773021 2726..2970 99 <- Minus

BO27533.pep Sequence

Translation from 16 to 2986

> BO27533.pep
MDERESLYFDTISLAESEAAAAAAAHRKSISQSRNTIYHSAVDLAGDEGG
GGSGGGRLRLGGGAAAEHAALAWQPGYRQSTALEHLNGGGGGGGDHTDAA
IAAQMIALQNGRNHLPTGIGVTGDGGQGGGDDETYRRFDDGKRSVDFVLA
YNGETQLEEHRRKCEIFEANLQREGLQLEHNKVQRVHFIKIHAPAEVLYR
YAEILKIKVPLKPIPGQDQIFAESAHEFKTCFSRMCKSLFSSVQLNTALF
PEREPRIHLEFSRNYLELYDTEHPNFLDASTRYSIINFILQRQRFVEGEE
TADNLGIEKLVQDGVYTCAYTLHDKDDRDRLLKEWANISKWKNLQPLDQI
KDYFGAKVALYFAWLGFYTQMLIPISVFGVLCFLYGFITWNSDPISRDIC
DDNGTIMCPQCDRSCDYWRLNETCTSSKFNYLIDNNMTVVFAFSMAIWAV
VYLEFWKRYSAGLVHRWGLTGFTHHVEHPRPQYLARISRTKKLAGKAYEQ
DHTGKRTILDPDVPFWSFKFLPNFTSYSIMVLFICISVIAIAGIIIYRMA
QRASHSILGSENSMTFKVMILPMTAGIIDLIVISLLDMVYSNLAVKLTNY
EYCRTQTEYDESLTIKNYVFQFVNYYSSLFYIAFLKGKFVGYPAKYNRVL
GFRQEECNPGGCLMELCMQLVIIMAGKQAVNAIVEMLIPYLMRTFKELSY
RHGWYKSHQDQRLVPYNQFTEDYNLLPAENNSLYVEYLEMVVQFGFITLF
SLAFPLAPLLALLNNVIEVRLDAIKMLRFLRRPVGMRARDIGVWHSIMTV
VTRIAVASSAMIIAFSTNLIPKIVYAASMGDPELNNYLNFTLAVFNTKDF
QVQPLLGGSQHVNETVCRYTEFRNSPEDPHPYKRPMIYWKILTGRLAFIV
IYQNIITMLQGILRWAVPDVSGRLLKRIKRENFLLREHIIEYEKQHAMKL
VQTELNGQQKSEGELRQRNNETVIRNRDEATSFVASFLDH

BO27533.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG10353-PK 1000 CG10353-PK 17..1000 1..984 5174 100 Plus
CG10353-PI 984 CG10353-PI 1..984 1..984 5174 100 Plus
CG10353-PC 984 CG10353-PC 1..984 1..984 5174 100 Plus
CG10353-PE 1029 CG10353-PE 17..1029 1..984 5134 97.1 Plus
CG10353-PL 1013 CG10353-PL 1..1013 1..984 5134 97.1 Plus