Clone BO27537 Report

Search the DGRC for BO27537

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptLpR1-RD
Protein status:BO27537.pep: Imported from assembly
Sequenced Size:2524

Clone Sequence Records

BO27537.complete Sequence

2524 bp assembled on 2010-10-15

GenBank Submission: KX796445

> BO27537.complete
GAAGTTATCAGTCGACATGGGGCGCATTTGGTGTTTACTCTTCGTTAGCA
GTTTGCTGCACACTCAGAGCCAAAGTTTTCGCGTTCTGGCTATAAATGAG
GCCACTTGCTCGTCGGACCAATTCCGTTGCGGGAATGGCAACTGCATACC
GAACAAATGGCGCTGCGATCAGGAGAGCGATTGTGCCGATGGCTCCGATG
AAGCCAACGAATTGTGCAGAGCTCGAACCTGTTCACCGGATGAATATGCC
TGCAAGAGTGGCGAGGGGCAATGTGTTCCTTTGGCCTGGATGTGCGACCA
GAGCAAGGACTGCAGCGATGGCTCCGACGAGCACAACTGCAACCAGACCT
GTCGTGCCGACGAGTTCACCTGCGGCAATGGACGGTGCATCCAGAAGCGA
TGGAAGTGCGACCACGACGACGACTGCGGCGATGGATCCGACGAGAAGGA
GTGCCCAGTGGTGCCCTGCGACTCCGTGGCGGAGCACACCTGCACGAATG
GAGCCTGCATCGCCAAGCGGTGGGTCTGCGACGGTGATCCGGACTGCTCC
GATGGCTCCGATGAGCGGTCCTGTGCGAATGTGACCAAGACGACCACGCC
CTGCTTATCGCACGAATACCAGTGCAAGGATCGCATCACCTGCCTGCATC
ACAGCTGGCTCTGCGATGGTGACCGCGACTGTCCCGATGGCGACGATGAG
CACACAGCCAACTGCAAGAACGTCACCTGCCGGGCGGACCAGTTCCAGTG
CGGCGATCGCAGCTGCATTCCAGGACATCTCACCTGCAACGGCGACAAGG
ACTGCGCCGATGGCAGCGACGAACGGGATTGCGGATTGAGTCTGAGTCTG
GGGATCAACCAAGGAGGATGCAACGCAACCAGCGAATTCGACTGCGGTGG
AGGTCAGTGCGTTCCACTCTCGAAGGTCTGCGACAAGAGGAAGGATTGTC
CGGATGGCGAGGACGAGCCGGCAGGAAAGTGCGGGATAAACGAGTGCGCC
TCGAAGAACGGAGGCTGCATGCACCAGTGCATCGATCTGAAGGTGGGCCA
CCACTGCGAATGCCACGAGGGTTACAAGTTGTCTCCGGACAAGCGGAACT
GCCAGGATATCAATGAGTGCGAAGTTCCCGGAAAGTGCTCTCAGATATGC
GTGAACGAAATAGGAGGCTTCAAGTGTGAGTGCGAAGCGGGCTACATGAG
GGATCCCAAAAATCACACCAGATGCAAGGCCAGCGAGGGACACGCCTCCC
TGCTCCTGGCCAGACGCCATGACATCCGCAAGATAGCACTCGACCACATG
GAAATGACCTCCATTGTGAATAGTACAAAGGCAGCCACTGCCCTGGACTT
TGTGTTCCGCACGGGTATGATCTTCTGGAGCGATGTGACCACCCAGAGTA
TATATAAAGCACCGATTGATGAGGGAAACGAAAAGACGGTAGTGTTGACT
AAATCCTCGGTGACCTCGGATGGCCTGGCTGTCGATTGGATCTATAACCA
TGTCTACTTTACGGACACCCACAAGTGCACCATCGAACTGACCAACTTCG
AGGGCAGCATGGGTAAGGTCCTGGTAAAGGACTCCCTGGACATTCCTCGT
TCAATTGCTTTGGATCCCATTGAGGGCTGGATGTACTGGTCCGACTGGGG
CGCCTCTCCGCGCATCGAAAGGGCGGGTATGGATGGCTCCCACCGCACCA
CCATCATCAGCTATGACGTCAAGTGGCCCAATGGTATCACCTTAGACCTG
GTTAAGAAACGCATCTACTGGGTAGATGGCAAGCTTAACGTTATCTCGTC
GGCGAACTATGATGGCTCGCAAAGGAGCCAGGTGCTCTACTCCGGCGAAT
ACCTGCGACATCCCTTCTCGATCACCACCTTCGAGGACAATGTCTACTGG
ACCGACTGGGACAAACAGGCCGTCTTCAAGGCGAACAAGTTCACCGGGGA
GGATGTGGAGCCCGTTACAGCAATGCATATGCTCCAGCATCCAATGGTGG
TGCACGTGTACCATCCTTACCGCCAGCCGGATGGCGTGAATCACTGCCAG
TCGGTGAATGGCCACTGTTCTCATCTCTGCCTGCCAGCTCCCAGGATCAA
TGAGAGGAGTCCTCGCATATCCTGCGCCTGTCCCACCGGTCTGAAGCTGA
TGGTCGATGGCCTCATGTGCGTCGAGGATCTTGCCGACCAGCGTCCAGTG
AAAAACCATACTCAAATCGAAAAGACCACAACGCCCAGTGAGCAGCCGGA
TTCCGGCTTTATTGCACTGGTGGTCATAGCCAGTCTTAGTGGATTCGCTG
TCCTGCTATCGGTGCTCCTGCTCATTGGCTACCGCTACTGCAGCAAGCGA
CGCATCAACTCGATGAACTTCGAGAACCCCATCTACCGCAAGACCACCAC
CACAGAGGATCACTTCAGTTTGCGCAAAAATCTGCCGGCGCGGATCTACG
ACCACACCAGTGTCATGGATGAGGAGTACTCACCCGTCATAGGCATATCC
TCGTATGCAAGCTTTCTAGACCAT

BO27537.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
LpR1-RD 2493 CG31094-PD 1..2490 17..2506 12450 100 Plus
LpR1-RL 2937 CG31094-PL 526..2934 98..2506 12045 100 Plus
LpR1-RR 2607 CG31094-PR 434..2604 336..2506 10855 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
LpR1-RD 3369 CG31094-RD 245..2734 17..2506 12450 100 Plus
LpR1-RL 3798 CG31094-RL 755..3163 98..2506 12045 100 Plus
LpR1-RR 3286 CG31094-RR 481..2651 336..2506 10855 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25744980..25746393 1981..568 7070 100 Minus
3R 32079331 3R 25706816..25707928 1981..869 3015 84.7 Minus
3R 32079331 3R 25747007..25747233 568..342 1135 100 Minus
3R 32079331 3R 25744684..25744883 2180..1981 1000 100 Minus
3R 32079331 3R 25742154..25742316 2476..2314 815 100 Minus
3R 32079331 3R 25706287..25706479 2180..1988 680 90.2 Minus
3R 32079331 3R 25742392..25742525 2314..2181 670 100 Minus
3R 32079331 3R 25748103..25748225 341..219 615 100 Minus
3R 32079331 3R 25749269..25749390 219..98 610 100 Minus
3R 32079331 3R 25752061..25752142 98..17 410 100 Minus
3R 32079331 3R 25709411..25709513 448..346 260 83.5 Minus
Blast to na_te.dros performed on 2014-11-26 15:00:42 has no hits.

BO27537.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:22:57 Download gff for BO27537.complete
Subject Subject Range Query Range Percent Splice Strand
LpR1-RD 245..2734 17..2508 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:08 Download gff for BO27537.complete
Subject Subject Range Query Range Percent Splice Strand
LpR1-RD 245..2734 17..2508 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:38 Download gff for BO27537.complete
Subject Subject Range Query Range Percent Splice Strand
LpR1-RD 245..2734 17..2508 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:38 Download gff for BO27537.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25752061..25752142 17..98 100   Minus
3R 25749270..25749389 99..218 100 <- Minus
3R 25748103..25748225 219..341 100 <- Minus
3R 25747007..25747233 342..568 100 <- Minus
3R 25744980..25746392 569..1981 100 <- Minus
3R 25744684..25744882 1982..2180 100 <- Minus
3R 25742392..25742525 2181..2314 100 <- Minus
3R 25742154..25742315 2315..2476 100 <- Minus
3R 25741981..25742012 2477..2508 93 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:08 Download gff for BO27537.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21577783..21577864 17..98 100   Minus
arm_3R 21574992..21575111 99..218 100 <- Minus
arm_3R 21573825..21573947 219..341 100 <- Minus
arm_3R 21572729..21572955 342..568 100 <- Minus
arm_3R 21570702..21572114 569..1981 100 <- Minus
arm_3R 21570406..21570604 1982..2180 100 <- Minus
arm_3R 21568114..21568247 2181..2314 100 <- Minus
arm_3R 21567876..21568037 2315..2476 100 <- Minus
arm_3R 21567703..21567734 2477..2508 93 <- Minus

BO27537.pep Sequence

Translation from 16 to 2524

> BO27537.pep
MGRIWCLLFVSSLLHTQSQSFRVLAINEATCSSDQFRCGNGNCIPNKWRC
DQESDCADGSDEANELCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCS
DGSDEHNCNQTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEKECPVVP
CDSVAEHTCTNGACIAKRWVCDGDPDCSDGSDERSCANVTKTTTPCLSHE
YQCKDRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRSC
IPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCGGGQCVP
LSKVCDKRKDCPDGEDEPAGKCGINECASKNGGCMHQCIDLKVGHHCECH
EGYKLSPDKRNCQDINECEVPGKCSQICVNEIGGFKCECEAGYMRDPKNH
TRCKASEGHASLLLARRHDIRKIALDHMEMTSIVNSTKAATALDFVFRTG
MIFWSDVTTQSIYKAPIDEGNEKTVVLTKSSVTSDGLAVDWIYNHVYFTD
THKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWGASPRI
ERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDG
SQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPV
TAMHMLQHPMVVHVYHPYRQPDGVNHCQSVNGHCSHLCLPAPRINERSPR
ISCACPTGLKLMVDGLMCVEDLADQRPVKNHTQIEKTTTPSEQPDSGFIA
LVVIASLSGFAVLLSVLLLIGYRYCSKRRINSMNFENPIYRKTTTTEDHF
SLRKNLPARIYDHTSVMDEEYSPVIGISSYASFLDH

BO27537.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
LpR1-PD 830 CG31094-PD 1..830 1..830 4646 100 Plus
LpR1-PL 978 CG31094-PL 176..978 28..830 4508 100 Plus
LpR1-PG 889 CG31094-PG 1..889 1..830 4419 91 Plus
LpR1-PR 868 CG31094-PR 68..868 28..830 4358 97 Plus
LpR1-PQ 976 CG31094-PQ 176..976 28..830 4358 97 Plus
LpR1-PL 978 CG31094-PL 136..384 112..365 434 37.9 Plus
LpR1-PR 868 CG31094-PR 28..274 112..365 434 37.4 Plus
LpR1-PL 978 CG31094-PL 136..343 151..371 335 34.5 Plus
LpR1-PR 868 CG31094-PR 19..150 229..378 185 30.9 Plus