Clone BO27541 Report

Search the DGRC for BO27541

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptPHGPx-RD
Protein status:BO27541.pep: Imported from assembly
Sequenced Size:748

Clone Sequence Records

BO27541.complete Sequence

748 bp assembled on 2010-08-18

GenBank Submission: KX795973

> BO27541.complete
GAAGTTATCAGTCGACATGAGTCTCAGGCAGTTTCAGAACATTTCCCGCC
AGGCCCTCAGGTGCTACTCGATGAGGCGGACCCCTGGCCCCGTCCTCGAG
CTGAGTCGCGGTCAGAGGCAGTGCCTTCGCCTCTGCACCATCATGCTTCC
CGTGAGCTGTGCGGCCACGCCCATGAACGCCATCTCCTCAGCCGCCCAGC
ACTCCACAGCAGCTGCCATCGACATGTCTGCTAACGGAGATTACAAGAAC
GCCGCCTCGATCTACGAGTTCACCGTGAAGGATACCCATGGCAACGATGT
TTCCCTGGAAAAGTACAAGGGCAAGGTGGTCCTGGTGGTGAACATCGCCT
CCAAGTGCGGCCTGACCAAGAACAACTACGAGAAGCTGACGGATCTAAAG
GAGAAGTACGGCGAGCGCGGCCTGGTGATCCTCAACTTCCCGTGCAATCA
GTTTGGGTCCCAGATGCCGGAGGCCGATGGAGAGGCCATGGTGTGCCACC
TGCGCGACTCCAAGGCTGACATCGGCGAGGTGTTCGCCAAGGTCGATGTG
AATGGAGACAATGCGGCGCCGCTGTACAAATACCTAAAGGCCAAGCAGAC
CGGCACCCTGGGCAGCGGAATCAAGTGGAACTTCACCAAGTTTCTGGTGA
ACAAGGAGGGCGTGCCCATCAACCGATATGCCCCGACCACCGATCCCATG
GACATCGCCAAGGACATTGAAAAGCTGCTGGCAAGCTTTCTAGACCAT

BO27541.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-RD 717 CG12013-PD 1..714 17..730 3570 100 Plus
PHGPx-RC 597 CG12013-PC 82..594 218..730 2565 100 Plus
PHGPx-RA 510 CG12013-PA 1..507 224..730 2535 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-RD 1014 CG12013-RD 114..827 17..730 3570 100 Plus
PHGPx-RA 803 CG12013-RA 104..616 218..730 2565 100 Plus
PHGPx-RC 1148 CG12013-RC 449..961 218..730 2565 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3327860..3328185 218..543 1630 100 Plus
3L 28110227 3L 3327353..3327553 17..217 1005 100 Plus
3L 28110227 3L 3328249..3328439 540..730 955 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:45:43 has no hits.

BO27541.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:58 Download gff for BO27541.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RD 82..795 17..732 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:18 Download gff for BO27541.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RD 114..827 17..732 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:53 Download gff for BO27541.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RD 114..827 17..732 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:53 Download gff for BO27541.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3328251..3328439 542..732 98   Plus
3L 3327860..3328183 218..541 100 -> Plus
3L 3327353..3327553 17..217 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:18 Download gff for BO27541.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3328251..3328439 542..732 98   Plus
arm_3L 3327860..3328183 218..541 100 -> Plus
arm_3L 3327353..3327553 17..217 100 -> Plus

BO27541.pep Sequence

Translation from 16 to 748

> BO27541.pep
MSLRQFQNISRQALRCYSMRRTPGPVLELSRGQRQCLRLCTIMLPVSCAA
TPMNAISSAAQHSTAAAIDMSANGDYKNAASIYEFTVKDTHGNDVSLEKY
KGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFGSQM
PEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGS
GIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLLASFLDH

BO27541.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-PD 238 CG12013-PD 1..238 1..238 1237 100 Plus
PHGPx-PC 198 CG12013-PC 28..198 68..238 897 100 Plus
PHGPx-PA 169 CG12013-PA 1..169 70..238 887 100 Plus
CG15116-PA 193 CG15116-PA 33..191 75..238 403 50.6 Plus