Clone BO27544 Report

Search the DGRC for BO27544

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptPapss-RE
Protein status:BO27544.pep: Imported from assembly
Sequenced Size:1924

Clone Sequence Records

BO27544.complete Sequence

1924 bp assembled on 2010-09-13

GenBank Submission: KX795704

> BO27544.complete
GAAGTTATCAGTCGACATGCCGAATCCGCCAATTGGATTTTATCCCCATA
TCAAAAGAAGGTGCCTACAGGTGGCGACGAATGTGACCGAGCAAAAGCAC
CATGTCACCAGGGAGACGCGCGGCAAGAATTTGGGACTCTGTCGAGGATT
CCGAGGATGCACGGTGTGGCTGACTGGCCTCAGTGGAGCTGGAAAGACCT
CGATTGCCTTCGAACTGGAGGCGTACCTGGTATCCCGGGGCATTCCGGCC
TACGGGTTGGACGGCGACAACATTCGCACCGGACTGAACAAGAACCTGGG
CTTCACGCCCGCCGATCGCGAGGAAAACATTCGCCGCGTGGGCGAGGTGG
CCAAGTTGTTTGCCGACAGCGGAGTGGTGGCCATCTGCAGCTTCGTTTCG
CCCTTCGCCGACGATCGTGAGATGGCGCGCAAGATCCACAAGGATGCGGG
TCTGAAGTTCTATGAGATATTCGTGGACACACCGCTGGATGTGTGCGAAA
CCCGGGACGTGAAGGGTCTATACAAGAAGGCGCGCGAGGGCGTAATCAAA
GGATTCACGGGCATTACGCAGGAGTACGAGCGACCCCAGATGCCGGAGCT
GGTGGTCAACACGCACGGCTACACGGTGCGCGAGTCCACTCAGAAGCTGG
TGACGCTGCTCGAACAGGAGGGCATTATTCCACGCTCGCTGCGCGACGTA
GACCTGCTGCCGGAGCTTTATCCCAGCGAATCCATTGCCACGGAGGCACT
GCGTCACGAGGCCGAGTCGCTGCAAGCCATCGAAATCAGCACCGTGGAGC
TGCAGTGGGTGCAAGTACTGGCCGAGGGATGGGCATATCCACTGCGCGGC
TTCATGCGCGAGGATGAGTACCTGCAGACGCTGCACTTCAACACACTTCA
GAGCGGCATGGACGGTTCCTATCGCGAGAACCACTCGGTGCCCATTGTTT
TGAGCGCCACGCAGGCGGACAAGGATCGTCTGGACGGCTGCTCCTCGCTG
ACTCTCAAATACCAAGGCAAGGCGGTAGCCATTCTGCGGCGTCCCGAGTT
CTACTTTCAGCGTAAGGAGGAGCGGCTGGCCCGCCAGTTCGGCACCAGCA
ATCCCAATCACCCGTACAGTAAGCAGGTCTACGAGTCCGGGGATTATTTG
GTCGGTGGCGATCTGGCAGTGATCGAACGTATCCGCTGGGAGGACGGACT
GGATCAGTACAGGCTGACTCCCAACGAGTTAAGGCGCCGCTTTAAGGAGC
TGAATGCCGACGCCATCTTCGCCTTTCAGTTGCGCAATCCCATCCACAAC
GGCCATGCCCTGCTCATGCAAGACACTCGCCGCCAGCTGCTGGAGCGCGG
CTTCAAGCAGCCAGTGCTGCTGCTGCATCCTCTGGGTGGCTGGACCAAGG
ACGACGATGTGCCGCTGGATGTGCGCATGAAGCAGCACCAGGCCGTGCTC
GACGCAGGTGTCTTGCGACGAGAGGACACAGTGCTGGCCATCTTCCCCTC
GCCAATGATGTACGCCGGTCCCACGGAGGTGCAGTGGCACGCAAAGGCGC
GCATGAACGCCGGTGCGAACTTCTACATTGTAGGCCGTGATCCGGCTGGC
ATGCCGCATCCGGCCAAGGAAACTTATCCGGATGGAAACCTATACGATGC
CACCCATGGTGCGCGAGTGCTTAAGATGGCCCAGGGACTAGACAGCATGG
AGATCCTGCCCTTCCGTGTTGCTGCCTATGACAAGAGCGCCAGTAGAATG
GCCTTCTTCGAGCCCAAGAGGAAGGATGAGTTTGAGTTCATCTCGGGAAC
CAAGATGCGCACCCTGGCCAAAACGGGAGCCAGTCCGCCGGATGGCTTCA
TGGAACCGGAGGCTTGGCGCATCCTGGCCACCTACTACCAGAACCTGCCG
CAGTCGGCAAGCTTTCTAGACCAT

BO27544.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-RH 1893 CG8363-PH 1..1890 17..1906 9435 99.9 Plus
Papss-RF 1893 CG8363-PF 1..1890 17..1906 9435 99.9 Plus
Papss-RE 1893 CG8363-PE 1..1890 17..1906 9435 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-RH 2686 CG8363-RH 480..2369 17..1906 9435 99.9 Plus
Papss-RF 2729 CG8363-RF 523..2412 17..1906 9435 99.9 Plus
Papss-RE 2396 CG8363-RE 190..2079 17..1906 9435 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19858814..19860340 176..1702 7620 99.9 Plus
3L 28110227 3L 19860403..19860608 1701..1906 1030 100 Plus
3L 28110227 3L 19858377..19858493 61..177 585 100 Plus
3L 28110227 3L 19848354..19848398 17..61 225 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:16:14 has no hits.

BO27544.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:48 Download gff for BO27544.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RF 519..2408 17..1908 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:50 Download gff for BO27544.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RE 190..2079 17..1908 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:07:22 Download gff for BO27544.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RE 190..2079 17..1908 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:07:22 Download gff for BO27544.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19860405..19860608 1703..1908 99   Plus
3L 19858815..19860340 177..1702 99 -> Plus
3L 19858378..19858492 62..176 100 -> Plus
3L 19848354..19848398 17..61 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:50 Download gff for BO27544.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19853505..19853708 1703..1908 99   Plus
arm_3L 19851915..19853440 177..1702 99 -> Plus
arm_3L 19851478..19851592 62..176 100 -> Plus
arm_3L 19841454..19841498 17..61 100 -> Plus

BO27544.pep Sequence

Translation from 16 to 1924

> BO27544.pep
MPNPPIGFYPHIKRRCLQVATNVTEQKHHVTRETRGKNLGLCRGFRGCTV
WLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDGDNIRTGLNKNLGFTPAD
REENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKFYE
IFVDTPLDVCETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTH
GYTVRESTQKLVTLLEQEGIIPRSLRDVDLLPELYPSESIATEALRHEAE
SLQAIEISTVELQWVQVLAEGWAYPLRGFMREDEYLQTLHFNTLQSGMDG
SYRENHSVPIVLSATQADKDRLDGCSSLTLKYQGKAVAILRRPEFYFQRK
EERLARQFGTSNPNHPYSKQVYESGDYLVGGDLAVIERIRWEDGLDQYRL
TPNELRRRFKELNADAIFAFQLRNPIHNGHALLMQDTRRQLLERGFKQPV
LLLHPLGGWTKDDDVPLDVRMKQHQAVLDAGVLRREDTVLAIFPSPMMYA
GPTEVQWHAKARMNAGANFYIVGRDPAGMPHPAKETYPDGNLYDATHGAR
VLKMAQGLDSMEILPFRVAAYDKSASRMAFFEPKRKDEFEFISGTKMRTL
AKTGASPPDGFMEPEAWRILATYYQNLPQSASFLDH

BO27544.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-PH 630 CG8363-PH 1..630 1..630 3310 100 Plus
Papss-PF 630 CG8363-PF 1..630 1..630 3310 100 Plus
Papss-PE 630 CG8363-PE 1..630 1..630 3310 100 Plus
Papss-PG 629 CG8363-PG 12..629 13..630 3223 99.5 Plus
Papss-PB 629 CG8363-PB 12..629 13..630 3223 99.5 Plus