Clone BO27546 Report

Search the DGRC for BO27546

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:46
Vector:pDNR-Dual
Associated Gene/Transcriptcbt-RA
Protein status:BO27546.pep: Imported from assembly
Sequenced Size:1318

Clone Sequence Records

BO27546.complete Sequence

1318 bp assembled on 2010-08-18

GenBank Submission: KX799041

> BO27546.complete
GAAGTTATCAGTCGACATGGACATGGATACCTTGCTACCTTCACCACCCG
CAACGCCCCCACTAAGGGAAAACAAGTTGGAAATCGTCGCCAAGGACGAA
CAACAGGTGAACGAGAATCTGCTAAAGGCAAAGCTCAAGCTGGTGGCCCA
AAAGAGTCAGAAAAATGGAGGGATTATTACACCAAATCCATCGGACACGG
AAGACGAGGCTCCCGAAATAGCGGTTCCCAACAAGAAACCCCGTTTGGAA
CAACCTGCTATGAGCATGACACCGCCGCCGGATCAAAAGCTGGACGATGA
TCAGAAAGCGGAAAGGGTTAGCGTCATCATGCGGGTCAACAGTTCTGGCG
CTGTCTCTTCTAGTAGCCAAGACGAGAACTCATCTAGTTCCACCTCCTGC
TGTAGTTCCTCTTCCAACACAAACACAAGTACAAGTTCAGTACCACCCAC
TGTGGAGGACGACTATCCAGAGGCCAATGTGTGGCGCAATCTCAAGTTCA
AAATGAACAGAAAGCGTGCTGCAGAAGTGGCACTACCCCCAGTACAAACA
CCCGAGACACCAGTTGCGAAGCTTGTAACGCCACCTGCTCCAGCGGAATG
CATCAAGGAGGAGGAAATAAAACCTATTCTGACACCGATATATGTTAGCC
CAGTAGCTTCGTCTGCCAGCCAACTTATCCTGCTCAGCACAGTGGCCGCC
CAACAGAGCCCCACACCCGTACCCAAAACGCCAACAATGTCCGAGGAGAA
ACTAACAACCAGAATTACGGCCGCCCAGGCGGCGGCCACCAGAAGTCGCA
TCTACGAGTGCAGTTTTCCCGATTGCGGCAAGAATTACTTCAAAAGCAGT
CATCTGAAGGCCCACCAGAGGGTTCACACCGGCGAGCGACCCTTTATCTG
CAAGTGGGAGAACTGTGACAAACGATTCTCCCGTTCCGATGAGTTGTCCC
GACACAAACGGACCCACACCGGTGAAAAGAAATTCCAGTGCAGCGTCTGC
CAGAAGAAATTCATGAGAAGCGATCACCTGTCGAAGCACGTCAAACGGCA
CAACAAGGACAAGGCGAACGGAGTGAATCGACATGTCTCCCTGGCCAACA
ACAACACATCAGCTTCGGTAGCGGCTTCCCTCTGCGATGCCTCGCTCCAT
TTGCGAGCGATAGCACCGGCGGGCTCCAGCGCTAGTTCCTCGCCCATCAG
TTCCGCCAGCTTGCAAGTCTACAGCGCCCAAGATCTGCTGAGGCTACAGC
AGCAGGCCAGCAGTTTCACCTTCGGCGGAACCCTGCTTCAAGTGCAGCGA
GCAAGCTTTCTAGACCAT

BO27546.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
cbt-RA 1287 CG4427-PA 1..1284 17..1300 6420 100 Plus
cbt-RC 1044 CG4427-PC 1..1041 260..1300 5205 100 Plus
cbt-RB 1044 CG4427-PB 1..1041 260..1300 5205 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
cbt-RA 2041 CG4427-RA 214..1497 17..1300 6420 100 Plus
cbt-RC 2361 CG4427-RC 603..1817 86..1300 6075 100 Plus
cbt-RB 3243 CG4427-RB 1485..2699 86..1300 6075 100 Plus
cbt-RC 2361 CG4427-RC 214..284 17..87 355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 476990..478204 1300..86 6075 100 Minus
2L 23513712 2L 479405..479475 87..17 355 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:46:00 has no hits.

BO27546.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:57:02 Download gff for BO27546.complete
Subject Subject Range Query Range Percent Splice Strand
cbt-RA 208..1491 17..1302 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:24 Download gff for BO27546.complete
Subject Subject Range Query Range Percent Splice Strand
cbt-RA 214..1497 17..1302 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:58 Download gff for BO27546.complete
Subject Subject Range Query Range Percent Splice Strand
cbt-RA 214..1497 17..1302 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:58 Download gff for BO27546.complete
Subject Subject Range Query Range Percent Splice Strand
2L 479407..479475 17..85 100   Minus
2L 476987..478204 86..1302 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:24 Download gff for BO27546.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 479407..479475 17..85 100   Minus
arm_2L 476987..478204 86..1302 99 <- Minus

BO27546.pep Sequence

Translation from 16 to 1318

> BO27546.pep
MDMDTLLPSPPATPPLRENKLEIVAKDEQQVNENLLKAKLKLVAQKSQKN
GGIITPNPSDTEDEAPEIAVPNKKPRLEQPAMSMTPPPDQKLDDDQKAER
VSVIMRVNSSGAVSSSSQDENSSSSTSCCSSSSNTNTSTSSVPPTVEDDY
PEANVWRNLKFKMNRKRAAEVALPPVQTPETPVAKLVTPPAPAECIKEEE
IKPILTPIYVSPVASSASQLILLSTVAAQQSPTPVPKTPTMSEEKLTTRI
TAAQAAATRSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENC
DKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRHNKDKA
NGVNRHVSLANNNTSASVAASLCDASLHLRAIAPAGSSASSSPISSASLQ
VYSAQDLLRLQQQASSFTFGGTLLQVQRASFLDH

BO27546.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
cbt-PA 428 CG4427-PA 1..428 1..428 2193 100 Plus
cbt-PC 347 CG4427-PC 1..347 82..428 1780 100 Plus
cbt-PB 347 CG4427-PB 1..347 82..428 1780 100 Plus
Spps-PA 968 CG5669-PA 606..874 170..397 364 30.9 Plus
Sp1-PB 520 CG1343-PB 127..298 215..371 359 44.8 Plus