Clone BO27547 Report

Search the DGRC for BO27547

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:47
Vector:pDNR-Dual
Associated Gene/Transcriptscramb1-RB
Protein status:BO27547.pep: full length peptide match
Sequenced Size:733

Clone Sequence Records

BO27547.complete Sequence

733 bp assembled on 2010-08-18

GenBank Submission: KX794861

> BO27547.complete
GAAGTTATCAGTCGACATGAGTATACCTACCGGAATTCCGAACTGTCCGC
GCGGATTGGAGTACCTTACGACTATCGACCAGCTTTTAGTTAAGCAAAAG
GTCGAGCTGCTCGAGGCCTTCACTGGTTTCGAGACCAACAACAAGTTCAC
GATCAAGAACGCCCTGGGTCAGAAGGTCTATTTCGCGGCGGAGGACAACG
ACTGCTGCACGCGCAATTGCTGTGGTCCTGCGCGTCCCTTCGACATGCGG
GTCTTTGATAACTTCCAGCAGGAAGTGATCCACATGCACCGCCCGCTGGC
CTGCTCCTCCTGTCTGTTTCCCTGCTGTCTGCAGAGTATCGAGGTCTCGG
CACCACCCGGCAATGTTATCGGCACCATTGAGCAGGAGTGGTCCATCTGT
TCGCCATCCTTCCGCATCCTCAACCACGTGGGTGACACGGTGATGCGCAT
CGAAGGACCTTTCTGCACCTTTTCGCTCTGCGGCGACGTTGAGTTCAATG
TTGTTTCGCTCACTGGTGAGAAGATAGGCAAGATCTCGAAACAGTGGTCG
GGCCTGGCACGTGAAATTTTCACGGATGCGGACTTCTTCGGCATCAATTT
CCCACTGGACTTGGATGTGCGCATGAAGGCCGTTTTGCTGGGTGCCACAT
TCCTCATAGATGCCATGTTCTTTGAGAAAGCCGGAAACCAAGAGACCGAT
AGGCCCGGAATGCTTGCAAGCTTTCTAGACCAT

BO27547.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
scramb1-RC 999 CG32056-PC 295..996 14..715 3495 99.9 Plus
scramb1-RB 702 CG32056-PB 1..699 17..715 3495 100 Plus
scramb1-RA 1251 CG32056-PA 550..1248 17..715 3495 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
scramb1-RC 1640 CG32056-RC 348..1049 14..715 3495 99.9 Plus
scramb1-RB 1655 CG32056-RB 364..1062 17..715 3495 100 Plus
scramb1-RA 2049 CG32056-RA 760..1458 17..715 3495 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10221609..10222093 501..17 2425 100 Minus
3L 28110227 3L 10221393..10221552 659..500 800 100 Minus
3L 28110227 3L 10221076..10221132 715..659 285 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:45:54 has no hits.

BO27547.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:57:01 Download gff for BO27547.complete
Subject Subject Range Query Range Percent Splice Strand
scramb1-RC 349..1047 17..717 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:21 Download gff for BO27547.complete
Subject Subject Range Query Range Percent Splice Strand
scramb1-RA 760..1458 17..717 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:56 Download gff for BO27547.complete
Subject Subject Range Query Range Percent Splice Strand
scramb1-RA 760..1458 17..717 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:56 Download gff for BO27547.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10221611..10222093 17..499 100   Minus
3L 10221394..10221552 500..658 100 <- Minus
3L 10221074..10221132 659..717 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:21 Download gff for BO27547.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10214711..10215193 17..499 100   Minus
arm_3L 10214494..10214652 500..658 100 <- Minus
arm_3L 10214174..10214232 659..717 96 <- Minus

BO27547.pep Sequence

Translation from 16 to 733

> BO27547.pep
MSIPTGIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNAL
GQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCL
FPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFC
TFSLCGDVEFNVVSLTGEKIGKISKQWSGLAREIFTDADFFGINFPLDLD
VRMKAVLLGATFLIDAMFFEKAGNQETDRPGMLASFLDH

BO27547.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
scramb1-PB 233 CG32056-PB 1..233 1..233 1250 100 Plus
scramb1-PA 416 CG32056-PA 184..416 1..233 1250 100 Plus
scramb1-PC 332 CG32056-PC 101..332 2..233 1245 100 Plus
scramb2-PA 263 CG1893-PA 42..263 1..221 749 59.9 Plus
CG9084-PB 275 CG9084-PB 67..272 13..220 236 29.1 Plus