Clone BO27553 Report

Search the DGRC for BO27553

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:53
Vector:pDNR-Dual
Associated Gene/TranscriptPapss-RD
Protein status:BO27553.pep: Imported from assembly
Sequenced Size:2005

Clone Sequence Records

BO27553.complete Sequence

2005 bp assembled on 2010-09-13

GenBank Submission: KX794930

> BO27553.complete
GAAGTTATCAGTCGACATGTTTACCCGATGTGCCAATTCGCTTGGCCTCT
ACCATAATAATATTAACAATAACAACAGCGCTTGCTGTGCCGCTTCCCCG
AAAAGAAGCTGCCTTCCGAGTGTGGAAAAGCCTGAAGATGCGTGCCTACA
GGTGGCGACGAATGTGACCGAGCAAAAGCACCATGTCACCAGGGAGACGC
GCGGCAAGAATTTGGGACTCTGTCGAGGATTCCGAGGATGCACGGTGTGG
CTGACTGGCCTCAGTGGAGCTGGAAAGACCTCGATTGCCTTCGAACTGGA
GGCGTACCTGGTATCCCGGGGCATTCCGGCCTACGGGTTGGACGGCGACA
ACATTCGCACCGGACTGAACAAGAACCTGGGCTTCACGCCCGCCGATCGC
GAGGAAAACATTCGCCGCGTGGGCGAGGTGGCCAAGTTGTTTGCCGACAG
CGGAGTGGTGGCCATCTGCAGCTTCGTTTCGCCCTTCGCCGACGATCGTG
AGATGGCGCGCAAGATCCACAAGGATGCGGGTCTGAAGTTCTATGAGATA
TTCGTGGACACACCGCTGGATGTGTGCGAAACCCGGGACGTGAAGGGTCT
ATACAAGAAGGCGCGCGAGGGCGTAATCAAAGGATTCACGGGCATTACGC
AGGAGTACGAGCGACCCCAGATGCCGGAGCTGGTGGTCAACACGCACGGC
TACACGGTGCGCGAGTCCACTCAGAAGCTGGTGACGCTGCTCGAACAGGA
GGGCATTATTCCGCGCTCGCTGCGCGACGTAGACCTGCTGCCGGAGCTTT
ATCCCAGCGAATCCATTGCCACGGAGGCACTGCGTCACGAGGCCGAGTCG
CTGCAAGCCATCGAAATCAGCACCGTGGAGCTGCAGTGGGTGCAAGTACT
GGCCGAGGGATGGGCATATCCACTGCGCGGCTTCATGCGCGAGGATGAGT
ACCTGCAGACGCTGCACTTCAACACACTTCAGAGCGGCATGGACGGTTCC
TATCGCGAGAACCACTCGGTGCCCATTGTTTTGAGCGCCACGCAGGCGGA
CAAGGATCGTCTGGACGGCTGCTCCTCGCTGACTCTCAAATACCAAGGCA
AGGCGGTAGCCATTCTGCGGCGTCCCGAGTTCTACTTTCAGCGTAAGGAG
GAGCGGCTGGCCCGCCAGTTCGGCACCAGCAATCCCAATCACCCGTACAG
TAAGCAGGTCTACGAGTCCGGGGATTATTTGGTCGGTGGCGATCTGGCAG
TGATCGAACGTATCCGCTGGGAGGACGGACTGGATCAGTACAGGCTGACT
CCCAACGAGTTAAGGCGCCGCTTTAAGGAGCTGAATGCCGACGCCATCTT
CGCCTTTCAGTTGCGCAATCCCATCCACAACGGCCATGCCCTGCTCATGC
AAGACACTCGCCGCCAGCTGCTGGAGCGCGGCTTCAAGCAGCCAGTGCTG
CTGCTGCATCCTCTGGGTGGCTGGACCAAGGACGACGATGTGCCGCTGGA
TGTGCGCATGAAGCAGCACCAGGCCGTGCTCGACGCAGGTGTCTTGCGAC
GAGAGGACACAGTGCTGGCCATCTTCCCCTCGCCAATGATGTACGCCGGT
CCCACGGAGGTGCAGTGGCACGCAAAGGCGCGCATGAACGCCGGTGCGAA
CTTCTACATTGTAGGCCGTGATCCGGCTGGCATGCCGCATCCGGCCAAGG
AAACTTATCCGGATGGAAACCTATACGATGCCACCCATGGCGCGCGAGTG
CTTAAGATGGCCCAGGGACTAGACAGCATGGAGATCCTGCCCTTCCGTGT
TGCTGCCTATGACAAGAGCGCCAGTAGAATGGCCTTCTTCGAGCCCAAGA
GGAAGGATGAGTTTGAGTTCATCTCGGGAACCAAGATGCGCACCCTGGCC
AAAACGGGAGCCAGTCCGCCGGATGGCTTCATGGAACCGGAGGCTTGGCG
CATCCTGGCCACCTACTACCAGAACCTGCCGCAGTCGGCAAGCTTTCTAG
ACCAT

BO27553.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-RD 1974 CG8363-PD 1..1971 17..1987 9840 99.9 Plus
Papss-RG 1890 CG8363-PG 41..1887 141..1987 9220 99.9 Plus
Papss-RB 1890 CG8363-PB 41..1887 141..1987 9220 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-RD 2457 CG8363-RD 170..2140 17..1987 9840 99.9 Plus
Papss-RG 2432 CG8363-RG 269..2115 141..1987 9220 99.9 Plus
Papss-RB 2394 CG8363-RB 231..2077 141..1987 9220 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19858814..19860340 257..1783 7620 99.9 Plus
3L 28110227 3L 19860403..19860608 1782..1987 1030 100 Plus
3L 28110227 3L 19847478..19847603 17..142 630 100 Plus
3L 28110227 3L 19858377..19858493 142..258 585 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:15:26 has no hits.

BO27553.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:47 Download gff for BO27553.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RD 174..2138 23..1989 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:46 Download gff for BO27553.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RD 176..2140 23..1989 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:07:06 Download gff for BO27553.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RD 176..2140 23..1989 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:07:06 Download gff for BO27553.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19860405..19860608 1784..1989 99   Plus
3L 19858815..19860340 258..1783 99 -> Plus
3L 19858378..19858492 143..257 100 -> Plus
3L 19847484..19847603 23..142 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:46 Download gff for BO27553.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19853505..19853708 1784..1989 99   Plus
arm_3L 19851915..19853440 258..1783 99 -> Plus
arm_3L 19851478..19851592 143..257 100 -> Plus
arm_3L 19840584..19840703 23..142 100 -> Plus

BO27553.pep Sequence

Translation from 16 to 2005

> BO27553.pep
MFTRCANSLGLYHNNINNNNSACCAASPKRSCLPSVEKPEDACLQVATNV
TEQKHHVTRETRGKNLGLCRGFRGCTVWLTGLSGAGKTSIAFELEAYLVS
RGIPAYGLDGDNIRTGLNKNLGFTPADREENIRRVGEVAKLFADSGVVAI
CSFVSPFADDREMARKIHKDAGLKFYEIFVDTPLDVCETRDVKGLYKKAR
EGVIKGFTGITQEYERPQMPELVVNTHGYTVRESTQKLVTLLEQEGIIPR
SLRDVDLLPELYPSESIATEALRHEAESLQAIEISTVELQWVQVLAEGWA
YPLRGFMREDEYLQTLHFNTLQSGMDGSYRENHSVPIVLSATQADKDRLD
GCSSLTLKYQGKAVAILRRPEFYFQRKEERLARQFGTSNPNHPYSKQVYE
SGDYLVGGDLAVIERIRWEDGLDQYRLTPNELRRRFKELNADAIFAFQLR
NPIHNGHALLMQDTRRQLLERGFKQPVLLLHPLGGWTKDDDVPLDVRMKQ
HQAVLDAGVLRREDTVLAIFPSPMMYAGPTEVQWHAKARMNAGANFYIVG
RDPAGMPHPAKETYPDGNLYDATHGARVLKMAQGLDSMEILPFRVAAYDK
SASRMAFFEPKRKDEFEFISGTKMRTLAKTGASPPDGFMEPEAWRILATY
YQNLPQSASFLDH

BO27553.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-PD 657 CG8363-PD 1..657 1..657 3453 100 Plus
Papss-PG 629 CG8363-PG 7..629 35..657 3228 99 Plus
Papss-PB 629 CG8363-PB 7..629 35..657 3228 99 Plus
Papss-PA 629 CG8363-PA 7..629 35..657 3228 99 Plus
Papss-PC 629 CG8363-PC 7..629 35..657 3228 99 Plus