Clone BO27554 Report

Search the DGRC for BO27554

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:54
Vector:pDNR-Dual
Associated Gene/Transcriptfbp-RB
Protein status:BO27554.pep: Imported from assembly
Sequenced Size:1063

Clone Sequence Records

BO27554.complete Sequence

1063 bp assembled on 2010-08-18

GenBank Submission: KX795433

> BO27554.complete
GAAGTTATCAGTCGACATGGCGGCCAGTAGCGGTGATTCCAAAATGACCC
AACAGAGGCCAGCTTTCGACTCCAATGCGATGACGCTGACGCGTTTCGTG
CTGCAGGAGCAGCGAAAGTTCAAGAGCGCCACTGGCGATCTCTCCCAGCT
GCTCAACTCCATCCAGACCGCCATCAAGGCTACATCATCCGCGGTGCGGA
AGGCAGGTATCGCCAAGCTCCATGGATTCGCTGGCGACGTGAATGTCCAA
GGCGAGGAGGTCAAGAAACTGGACGTGCTCTCCAACGAGCTGTTCATCAA
CATGCTGAAGTCATCCTATACCACATGTCTAATGGTTTCCGAGGAGAACG
AGAATGTGATCGAGGTGGAAGTGGAGAAACAGGGCAAATACATCGTGTGC
TTCGATCCCTTGGATGGATCCTCCAACATAGACTGCCTGGTGTCGATCGG
TTCAATCTTCGCCATTTACCGCAAGAAAAGCGATGGTCCGCCCACAGTGG
AGGATGCACTGCAGCCCGGAAATCAGCTGGTGGCCGCCGGCTACGCGCTA
TACGGTTCGGCCACAGCAATTGTCCTGGGTCTGGGTTCGGGAGTGAATGG
CTTCACTTATGACCCGGCCATCGGAGAGTTCGTGCTGACCGATCCCAACA
TGCGGGTGCCGGAGAAGGGAAAGATATACTCTATCAACGAGGGATATGCA
GCGGATTGGGAGGATGGTGTCTTCAACTACATTGCGGCCAAGAAGGATCC
CGCCAAGGGAAAGCCCTATGGAGCGCGGTACGTGGGTTCCATGGTCGCGG
ATGTGCATCGCACCATTAAATACGGCGGCATCTTTATCTATCCGGCAACA
AAGTCCGCTCCCAGCGGAAAACTTCGTCTGCTGTACGAGTGCGTGCCCAT
GGCCTATCTGATGATCCAGGCTGGAGGTCTGGCCAGCGACGGAAAGATCA
GCATTTTGGACATTGTGCCCAAGAAGATCCACGAGCGCAGTCCCATATTC
CTAGGATCCAAGTCCGACGTGGAGGAGGCACTTAGCTACTTAAAGGCAAG
CTTTCTAGACCAT

BO27554.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
fbp-RE 1005 CG31692-PE 1..1002 44..1045 5010 100 Plus
fbp-RA 1005 CG31692-PA 1..1002 44..1045 5010 100 Plus
fbp-RD 969 CG31692-PD 1..966 80..1045 4830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
fbp-RE 1202 CG31692-RE 118..1146 17..1045 5145 100 Plus
fbp-RA 1130 CG31692-RA 66..1074 37..1045 5045 100 Plus
fbp-RD 1185 CG31692-RD 140..1129 56..1045 4950 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19761643..19762308 1045..380 3330 100 Minus
2L 23513712 2L 19762487..19762831 383..39 1725 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:45:20 has no hits.

BO27554.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:51 Download gff for BO27554.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RB 116..1144 17..1047 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:11 Download gff for BO27554.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RE 118..1146 17..1047 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:47 Download gff for BO27554.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RE 118..1146 17..1047 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:47 Download gff for BO27554.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19763426..19763447 17..38 100   Minus
2L 19762488..19762831 39..382 100 <- Minus
2L 19761640..19762305 383..1047 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:11 Download gff for BO27554.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19763426..19763447 17..38 100   Minus
arm_2L 19762488..19762831 39..382 100 <- Minus
arm_2L 19761640..19762305 383..1047 99 <- Minus

BO27554.pep Sequence

Translation from 16 to 1063

> BO27554.pep
MAASSGDSKMTQQRPAFDSNAMTLTRFVLQEQRKFKSATGDLSQLLNSIQ
TAIKATSSAVRKAGIAKLHGFAGDVNVQGEEVKKLDVLSNELFINMLKSS
YTTCLMVSEENENVIEVEVEKQGKYIVCFDPLDGSSNIDCLVSIGSIFAI
YRKKSDGPPTVEDALQPGNQLVAAGYALYGSATAIVLGLGSGVNGFTYDP
AIGEFVLTDPNMRVPEKGKIYSINEGYAADWEDGVFNYIAAKKDPAKGKP
YGARYVGSMVADVHRTIKYGGIFIYPATKSAPSGKLRLLYECVPMAYLMI
QAGGLASDGKISILDIVPKKIHERSPIFLGSKSDVEEALSYLKASFLDH

BO27554.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
fbp-PE 334 CG31692-PE 1..334 10..343 1702 100 Plus
fbp-PA 334 CG31692-PA 1..334 10..343 1702 100 Plus
fbp-PD 322 CG31692-PD 1..322 22..343 1640 100 Plus
fbp-PC 322 CG31692-PC 1..322 22..343 1640 100 Plus