Clone BO27556 Report

Search the DGRC for BO27556

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG32195-RA
Protein status:BO27556.pep: Imported from assembly
Sequenced Size:1237

Clone Sequence Records

BO27556.complete Sequence

1237 bp assembled on 2010-08-18

GenBank Submission: KX795838

> BO27556.complete
GAAGTTATCAGTCGACATGGAGCGGGAAATTTACAGTGCGGAATACTTCG
AGAGAGCTTTGGCGAGAGCTTATGGTTGTGAAATGCTTCGCGTTGAGAAC
TTTCACATCAAGGCGGTGAGCCAGAAGGGCGAGAACTTTTGCAGCGTCAT
CTACCGGGTGGCGTTGGTCTTTCGCAGGTCACCCGATGGCGCTCTCGAAT
CAGGAAAATATATTCTCAAGGATCTGCTGCCCGCCGCCGCTGCACTGGGC
ACCAACGAAAAGGATATGTTCGAGGTACTCCTGCCTGCCATGCAAGCCAT
TCTTGAAGAAGCTCCAAAGGAGATTGGCGAACACAAGCTGAGCGCAGATT
GCTTGCTAGTCGAGATATCTGCTGGAAAAGAGCTCTACATTCTGGAGGAT
CTGGGCGCCCTAGGATACGAATCCTTTGATCGTCGTCAAGGCTTAAATCT
GGAAGAAGCCAAAATTTGCGTAAGGAAACTGGCTCAGTTCCACGGTGCAT
CCAAGGTTTTGTACGAGAAGAAACCCGAATTGATTCAAAGGCTTTCGCCT
TCTCACTATGCCAATGGATTGAACGATCGCTTCGCCCAGGCTCTCGTCTT
GGAGGGCGCCGAATATGCCGCAGAAGCGTTTGCCGAAGAACTTCCGGAAA
TATCAAAGAAAATGAAGGCTCAAATACCGAAAGCATATACGAAAAGAATG
CGAGATGTCGTTGATCCAAACAAGTCATCATTGAATGCAGTTATTCATGG
TGATCCCTGGTTAAATAACATTATGTTTGATTTCGTTAATAAGAAGGCAA
CACTTGTGGATTTCCAAAACTGTTACTGGGGTAGCCCGGCCATAGATCTC
TACTTTCTATTTTACACCAGCCTCAAGCCTGAATTATTGCTAAATAATCA
AGATGAGCTTCTGAATTACTATTTCGACAATCTTCTGGAAACCCTGCGGC
ATTGCGGCTATAAAGACACACTGCCCACTTTTGGCCAGTTAAAGGATGAG
ATGAAACGGTGTTTGTTTTATGGATATTACACTGTAGTCTGTGAACTTCC
CATATGTTGTGCTTCCCCTGAGGCAAGTGTTGATTTCGGGGTTCACACCT
TCGTAGATACGGATGCTATGTTAAAAAAGCGACACCAATTATTCGCCAGC
GAACGAGTGCGTCAAACCATAAAGGCCACTCTGCTTATGTTCGATCGTGA
GGGTATATTAGAGACGCCCGCAAGCTTTCTAGACCAT

BO27556.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG32195-RC 1206 CG32195-PC 1..1203 17..1219 6015 100 Plus
CG32195-RB 1206 CG32195-PB 1..1203 17..1219 6015 100 Plus
CG32195-RA 1206 CG32195-PA 1..1203 17..1219 6015 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32195-RC 1563 CG32195-RC 143..1345 17..1219 6015 100 Plus
CG32195-RB 1701 CG32195-RB 281..1483 17..1219 6015 100 Plus
CG32195-RA 4876 CG32195-RA 281..1483 17..1219 6015 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18114823..18115282 349..808 2300 100 Plus
3L 28110227 3L 18115344..18115757 806..1219 2070 100 Plus
3L 28110227 3L 18114426..18114757 17..348 1660 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:45:09 has no hits.

BO27556.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:49 Download gff for BO27556.complete
Subject Subject Range Query Range Percent Splice Strand
CG32195-RA 270..1472 17..1221 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:06 Download gff for BO27556.complete
Subject Subject Range Query Range Percent Splice Strand
CG32195-RA 281..1483 17..1221 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:44 Download gff for BO27556.complete
Subject Subject Range Query Range Percent Splice Strand
CG32195-RA 281..1483 17..1221 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:44 Download gff for BO27556.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18115344..18115757 806..1221 99   Plus
3L 18114823..18115279 349..805 100 -> Plus
3L 18114426..18114757 17..348 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:06 Download gff for BO27556.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18108444..18108857 806..1221 99   Plus
arm_3L 18107923..18108379 349..805 100 -> Plus
arm_3L 18107526..18107857 17..348 100 -> Plus

BO27556.pep Sequence

Translation from 16 to 1237

> BO27556.pep
MEREIYSAEYFERALARAYGCEMLRVENFHIKAVSQKGENFCSVIYRVAL
VFRRSPDGALESGKYILKDLLPAAAALGTNEKDMFEVLLPAMQAILEEAP
KEIGEHKLSADCLLVEISAGKELYILEDLGALGYESFDRRQGLNLEEAKI
CVRKLAQFHGASKVLYEKKPELIQRLSPSHYANGLNDRFAQALVLEGAEY
AAEAFAEELPEISKKMKAQIPKAYTKRMRDVVDPNKSSLNAVIHGDPWLN
NIMFDFVNKKATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQDELLN
YYFDNLLETLRHCGYKDTLPTFGQLKDEMKRCLFYGYYTVVCELPICCAS
PEASVDFGVHTFVDTDAMLKKRHQLFASERVRQTIKATLLMFDREGILET
PASFLDH

BO27556.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG32195-PC 401 CG32195-PC 1..401 1..401 2084 100 Plus
CG32195-PB 401 CG32195-PB 1..401 1..401 2084 100 Plus
CG32195-PA 401 CG32195-PA 1..401 1..401 2084 100 Plus
CG10513-PB 422 CG10513-PB 23..419 10..399 454 30.1 Plus
CG11892-PA 439 CG11892-PA 35..436 4..399 404 27.5 Plus